KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs2050Help
Entry
gbs2050           CDS       T00104                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:san00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    gbs2050 (ruvA)
Enzymes [BR:san01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     gbs2050 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2122583..2123173)
Genome map
AA seq 196 aa AA seqDB search
MYDYIKGKLSKITAKFIVVETAGLGYMIYVANPYSFSGYVNQEVTIYLHQVIRDDAHLLF
GFHTENEKEIFLNLISVSGIGPTTALAIIAVDDNEGLVSAIDNSDIKYLTKFPKIGKKTA
QQMILDLSGKFVEASGESATSRKVSSEQNSNLEEAMEALLALGYKATELKKVKAFFEGTN
ETVEQYIKSSLKMLMK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtacgattatattaaaggaaaattgagtaaaataacggctaaatttattgttgtggaa
acagctggattgggatacatgatatatgtggcaaatccctactctttttcaggttacgtt
aatcaagaagttaccatctacttacatcaagtcattcgcgatgatgcacatcttttattt
ggttttcatacggaaaatgaaaaagaaatttttcttaatttaatttcagtatcaggaatt
ggtccaacgaccgctttagcaattattgcagtcgatgacaatgaaggtctcgtaagtgcc
attgataatagtgatattaagtatttgactaaatttccaaagataggaaaaaaaacagca
caacagatgatccttgatttgtcagggaagtttgtagaagcttctggtgagagtgcgact
agtcgtaaggttagctctgagcagaatagcaatcttgaagaagctatggaagctttgtta
gcgttggggtataaggcgactgaattgaaaaaagtaaaagccttttttgaaggtacgaac
gagactgtggagcaatacatcaaatctagtttgaagatgttgatgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system