KEGG   Streptococcus anginosus C238: SANR_0083Help
Entry
SANR_0083         CDS       T02829                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sanc  Streptococcus anginosus C238
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Benzoate degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sanc01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sanc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sanc00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sanc00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sanc00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:sanc00362]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sanc00625]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:sanc00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
69050..71701
Genome map
AA seq 883 aa AA seqDB search
MADKKTVAKEDKVLAAQKHVDELVQKGLVALEEMRKLDQEQVDYIVAKASVAALDAHGQL
ALHALEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGIIDEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAAQIVRDAAIAAGAPENCVQW
ITQPSMEATTALMNHEGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEVYNEFLEEFKSYHTYFVNKKEKALLEDFCFGV
KANSKNCAGAKLNPDIVGKSAVWIAEQAGFSVPEDTNILAAECKEVGEKEPLTREKLSPV
IAVLKSESREDGINKARQMVEFHGLGHSAAIHTADEELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAVNLLNIKKVGRRNNNMQWFKVPSKTYFER
NSIQYLQKCRDVERVMIVTDHSMVELGFLDRIIEQLELRRNKVTYQIFAEVEPDPDISTV
MKGTDLMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPQ
LGRKTKFIGIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGF
IAADTGMDVLTHATEAYVSQMANDFTDGLALQAIKLVFEHLENSVKNADFHSREKMHNAS
TMAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKAATWPKYNY
YRADEKYQDIAKLLGLPASTPEEGVESYAKAVYELGERVGIKMNFRDQGIDEKEWKEHSR
ELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactgtagcaaaagaagacaaagtcttagctgctcaaaaacacgtg
gatgaacttgttcaaaagggtcttgttgcgcttgaggaaatgcgtaaattagatcaagaa
caagttgattatatcgttgcgaaagcttctgttgctgcgcttgatgcacatggtcaactg
gctttacatgctctagaagaaactgggcgtggtgtttttgaagacaaagcaaccaaaaat
ctctttgcttgtgaacatgtggtaaacaatatgcgccataccaaaactgttggaatcatt
gatgaagacgacgtgactggtttgacacttattgcagaaccggtcggcgttgtctgtgga
atcacaccgacaacaaacccaacttcaacagcaattttcaaatcattaatttctttgaaa
acgcgtaatcctattatctttgctttccacccatcagctcaagaatcttctgctcatgcg
gcacaaatcgtacgtgatgcagcgattgcagcaggtgcacctgaaaattgtgttcaatgg
attacacagccatctatggaagcaacaacagctttgatgaaccacgaagggattgcaaca
atccttgcgactggtgggaacgccatggtaaaagctgcctattcatgcggcaaacctgct
cttggagttggtgctggtaacgttccagcttacgttgaaaaatcagcaaatatccgccaa
gcagcacatgatatcgtgatgtccaaatcatttgataacggaatggtctgtgcttctgag
caagctgttatcattgataaagaagtctacaatgagtttcttgaagaatttaaatcttat
cacacttactttgtcaataagaaagaaaaagctcttttggaagatttctgctttggtgtg
aaagccaacagcaaaaattgcgcaggtgctaaattaaatccagatattgttggtaaatca
gctgtttggattgcggagcaagcaggtttctctgtaccagaagatacaaatattttggct
gcagaatgtaaggaagttggcgaaaaagaaccgttgacacgtgaaaaattgtcaccagtc
atcgctgttttgaaatcagaatctcgtgaagacggcattaacaaggctcgtcaaatggtt
gaattccatggacttggtcactcagcggctattcatacagcagatgaagaattgacaaaa
gaatttggtaaagctgtaaaagcgattcgtgtgatttgcaattcaccttctactttcggt
ggtatcggggacgtttacaatgcatttttaccttcattaacattaggatgtggctcttat
ggacgcaactctgttggtgataatgtcagtgctgtaaatctcttgaatatcaaaaaagta
ggaagacgtaataataatatgcaatggtttaaagttccttcaaaaacatacttcgaacgc
aattcaattcaatatctacaaaaatgtcgtgatgtagagcgtgtcatgattgtcacagac
cactcaatggttgaattaggattccttgaccgcattattgagcagttagaacttcgtcgc
aataaagtaacctatcaaatctttgcagaggttgaaccagatccagatatttcgactgta
atgaagggaacagatttgatgcgtaccttcaaaccggatacaattattgctttgggtggt
ggttcaccaatggatgcggcaaaagttatgtggcttttctatgaacaaccagaagtagac
ttccatgaccttgttcaaaaattcatggatattcgtaaacgtgccttcaagttccctcag
cttggcagaaaaacgaaatttatcggtattccgacaacttcaggtacaggttcagaagtt
actccatttgctgttatctctgataaagctaataaccgtaaatacccaattgcagactat
tcattgacgccgacagttgctattgttgaccctgcgctggtattgactgttccaggattt
atcgcagctgatactggtatggacgtattgacacatgcgacagaagcctatgtttctcaa
atggcaaatgactttacagacggtttggcattgcaagcgattaaattagtttttgaacat
cttgaaaattctgtgaagaatgctgatttccactctcgtgaaaagatgcacaatgcttca
actatggcgggtatggcgtttgccaatgctttccttggaatttctcactcaatggctcac
aagattggtgcacaattccatacaattcatggtcggacaaatgccatcctgttgccgtat
gttattcgctataatggtactcgccctgctaaagcagctacatggcctaagtacaactac
taccgtgctgatgaaaaataccaagatattgctaaattgctcggtcttccagcttctact
ccagaagaaggcgttgaatcatatgccaaagcggtttacgaacttggtgagcgtgtagga
attaaaatgaacttccgtgatcaaggaatcgatgagaaagaatggaaagaacattctcgt
gagttagcattcttagcttatgaagatcagtgttcaccagcgaatcctcgtcttccaatg
gttgaccatatgcaagaaatcattgaagatgcatattatggatacaaagaacgtccagga
cgtcggaaataa

DBGET integrated database retrieval system