KEGG   Streptococcus anginosus C238: SANR_0083Help
Entry
SANR_0083         CDS       T02829                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sanc  Streptococcus anginosus C238
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sanc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SANR_0083 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SANR_0083 (adhE)
   00620 Pyruvate metabolism
    SANR_0083 (adhE)
   00650 Butanoate metabolism
    SANR_0083 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SANR_0083 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SANR_0083 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SANR_0083 (adhE)
   00626 Naphthalene degradation
    SANR_0083 (adhE)
Enzymes [BR:sanc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SANR_0083 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SANR_0083 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
69050..71701
Genome map
AA seq 883 aa AA seqDB search
MADKKTVAKEDKVLAAQKHVDELVQKGLVALEEMRKLDQEQVDYIVAKASVAALDAHGQL
ALHALEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGIIDEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAAQIVRDAAIAAGAPENCVQW
ITQPSMEATTALMNHEGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEVYNEFLEEFKSYHTYFVNKKEKALLEDFCFGV
KANSKNCAGAKLNPDIVGKSAVWIAEQAGFSVPEDTNILAAECKEVGEKEPLTREKLSPV
IAVLKSESREDGINKARQMVEFHGLGHSAAIHTADEELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAVNLLNIKKVGRRNNNMQWFKVPSKTYFER
NSIQYLQKCRDVERVMIVTDHSMVELGFLDRIIEQLELRRNKVTYQIFAEVEPDPDISTV
MKGTDLMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPQ
LGRKTKFIGIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGF
IAADTGMDVLTHATEAYVSQMANDFTDGLALQAIKLVFEHLENSVKNADFHSREKMHNAS
TMAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKAATWPKYNY
YRADEKYQDIAKLLGLPASTPEEGVESYAKAVYELGERVGIKMNFRDQGIDEKEWKEHSR
ELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactgtagcaaaagaagacaaagtcttagctgctcaaaaacacgtg
gatgaacttgttcaaaagggtcttgttgcgcttgaggaaatgcgtaaattagatcaagaa
caagttgattatatcgttgcgaaagcttctgttgctgcgcttgatgcacatggtcaactg
gctttacatgctctagaagaaactgggcgtggtgtttttgaagacaaagcaaccaaaaat
ctctttgcttgtgaacatgtggtaaacaatatgcgccataccaaaactgttggaatcatt
gatgaagacgacgtgactggtttgacacttattgcagaaccggtcggcgttgtctgtgga
atcacaccgacaacaaacccaacttcaacagcaattttcaaatcattaatttctttgaaa
acgcgtaatcctattatctttgctttccacccatcagctcaagaatcttctgctcatgcg
gcacaaatcgtacgtgatgcagcgattgcagcaggtgcacctgaaaattgtgttcaatgg
attacacagccatctatggaagcaacaacagctttgatgaaccacgaagggattgcaaca
atccttgcgactggtgggaacgccatggtaaaagctgcctattcatgcggcaaacctgct
cttggagttggtgctggtaacgttccagcttacgttgaaaaatcagcaaatatccgccaa
gcagcacatgatatcgtgatgtccaaatcatttgataacggaatggtctgtgcttctgag
caagctgttatcattgataaagaagtctacaatgagtttcttgaagaatttaaatcttat
cacacttactttgtcaataagaaagaaaaagctcttttggaagatttctgctttggtgtg
aaagccaacagcaaaaattgcgcaggtgctaaattaaatccagatattgttggtaaatca
gctgtttggattgcggagcaagcaggtttctctgtaccagaagatacaaatattttggct
gcagaatgtaaggaagttggcgaaaaagaaccgttgacacgtgaaaaattgtcaccagtc
atcgctgttttgaaatcagaatctcgtgaagacggcattaacaaggctcgtcaaatggtt
gaattccatggacttggtcactcagcggctattcatacagcagatgaagaattgacaaaa
gaatttggtaaagctgtaaaagcgattcgtgtgatttgcaattcaccttctactttcggt
ggtatcggggacgtttacaatgcatttttaccttcattaacattaggatgtggctcttat
ggacgcaactctgttggtgataatgtcagtgctgtaaatctcttgaatatcaaaaaagta
ggaagacgtaataataatatgcaatggtttaaagttccttcaaaaacatacttcgaacgc
aattcaattcaatatctacaaaaatgtcgtgatgtagagcgtgtcatgattgtcacagac
cactcaatggttgaattaggattccttgaccgcattattgagcagttagaacttcgtcgc
aataaagtaacctatcaaatctttgcagaggttgaaccagatccagatatttcgactgta
atgaagggaacagatttgatgcgtaccttcaaaccggatacaattattgctttgggtggt
ggttcaccaatggatgcggcaaaagttatgtggcttttctatgaacaaccagaagtagac
ttccatgaccttgttcaaaaattcatggatattcgtaaacgtgccttcaagttccctcag
cttggcagaaaaacgaaatttatcggtattccgacaacttcaggtacaggttcagaagtt
actccatttgctgttatctctgataaagctaataaccgtaaatacccaattgcagactat
tcattgacgccgacagttgctattgttgaccctgcgctggtattgactgttccaggattt
atcgcagctgatactggtatggacgtattgacacatgcgacagaagcctatgtttctcaa
atggcaaatgactttacagacggtttggcattgcaagcgattaaattagtttttgaacat
cttgaaaattctgtgaagaatgctgatttccactctcgtgaaaagatgcacaatgcttca
actatggcgggtatggcgtttgccaatgctttccttggaatttctcactcaatggctcac
aagattggtgcacaattccatacaattcatggtcggacaaatgccatcctgttgccgtat
gttattcgctataatggtactcgccctgctaaagcagctacatggcctaagtacaactac
taccgtgctgatgaaaaataccaagatattgctaaattgctcggtcttccagcttctact
ccagaagaaggcgttgaatcatatgccaaagcggtttacgaacttggtgagcgtgtagga
attaaaatgaacttccgtgatcaaggaatcgatgagaaagaatggaaagaacattctcgt
gagttagcattcttagcttatgaagatcagtgttcaccagcgaatcctcgtcttccaatg
gttgaccatatgcaagaaatcattgaagatgcatattatggatacaaagaacgtccagga
cgtcggaaataa

DBGET integrated database retrieval system