KEGG   Streptococcus anginosus C238: SANR_0635Help
Entry
SANR_0635         CDS       T02829                                 

Gene name
glgB
Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sanc  Streptococcus anginosus C238
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sanc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
651597..653507
Genome map
AA seq 636 aa AA seqDB search
MDRQEALRTFTTGENFHLQHYLGVHQDEVDGQSGYTFRVWAPNAQSVHLIGDFTDWYENQ
IPMTRNEGGVWEVFTDLPKEGDIYKYNVKRSSGQEILKIDPLAIYFEKRPGTGAVIRTIP
EKKWKDGLWLARRKRWGFFSRPVNIYEAHVGSWKKNEDGSPYSFAQLKDELIPYLVKMDY
THVEFMPLMAHPLGLSWGYQLMGYFALEHTYGTPEEFRDFVEECHVNNIGVIVDWVPGHF
TINDDALAYYDGTPTFEYQDHDRAHNYGWGALNFDLGKNEVQSFLISSIKFWIDFYHLDG
IRVDAVSNMLYLDYDSGPWQPNIDGGNRNYEGYYFLQRLNTVIKLAHPDVMMIAEESTSD
TKITGMIEMGGLGFDYKWNMGWMNDILRFYEENPIYRKYDFNLVTFSFMYAFSENFLLPF
SHDEVVHGKKSLMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEWGQFLEWKCEES
LEWRDLADDMNAKMQHFTSRLNQLYKENRVLWENDLNWDGLEIIDADNTDQSVLSFIRKN
DKGDMLICVFNMAPVERKDFTIGVPVTAIYEEIWNTELEEWGGVWKEYNQTVQSQEGLWK
DYPQTLTFTLPALGASIWKIKRRVKSANGSKKSKKE
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggatagacaagaagcattgagaacttttaccacaggtgaaaatttccatttacagcac
tatttgggggttcatcaagatgaagttgatggacaaagcggctatacctttcgtgtatgg
gcgccaaatgctcaaagtgtgcatttaataggagactttaccgactggtatgaaaatcag
attcctatgacacgcaatgaaggtggcgtatgggaagtattcacggatttgccaaaggaa
ggagatatttacaaatacaacgttaaacgaagcagtggtcaagaaattttaaaaattgat
cccttagctatctattttgaaaaacgtcctggtacaggtgcagtaattcggacgattcca
gaaaagaaatggaaagatggtctatggttagctcgcagaaaacgttgggggtttttctca
cgtccagtgaatatttacgaagctcatgtaggttcctggaagaaaaatgaggatggtagc
ccgtattcatttgctcaattaaaagatgaactgattccttatttggttaaaatggattat
actcatgtggaattcatgccactaatggcgcatccacttggattgagctggggttatcag
ctaatgggatattttgcacttgagcacacgtatggaacgcctgaagagtttcgtgatttt
gttgaagaatgtcatgtcaataatatcggagttattgttgactgggtgccgggtcatttt
actatcaatgatgatgccttggcttattatgacggtacacctacgtttgaatatcaggat
catgaccgtgcccataattacggctggggcgctctcaattttgacttaggaaagaatgaa
gtgcagtctttcttgatttctagtatcaagttttggattgacttttatcacttagacgga
atccgcgtggatgctgttagcaacatgctctacctagattatgatagtggtccatggcaa
ccaaatattgacgggggcaatcgcaactacgaaggctattacttccttcaacgattgaat
acggttatcaagcttgcccacccagatgtcatgatgattgcagaagaaagtacgagtgat
acaaagattacggggatgatagaaatgggtggtcttggatttgactacaagtggaacatg
ggctggatgaatgacattctgcgtttctacgaagaaaatccgatttaccgcaagtatgat
tttaatctagtaacctttagtttcatgtacgctttttctgaaaacttcttgttgccattt
tctcatgacgaagtggtacatggtaagaagagtctcatgcataagatgtggggagatcgc
tataatcaatttgctggtctgcgaaatctctatacttatcaaatatgtcacccagggaag
aaattactattcatgggcagcgaatggggacaattcttagaatggaaatgcgaagaatct
ttagaatggcgtgatttggcagatgatatgaacgctaagatgcaacatttcacttctcga
ctcaatcagctttataaagaaaatcgtgttttatgggaaaacgacttgaattgggatggc
ttagaaattattgatgcggataatacagatcaaagtgtactttcctttattcggaaaaat
gacaagggagatatgctaatttgcgtctttaatatggctccggtagagcgcaaagacttt
accattggtgttccggtgacagccatatatgaagaaatttggaatactgaattagaagaa
tggggaggtgtatggaaagagtataatcaaacagttcagtctcaagaaggcttgtggaag
gattatcctcagacgttgacctttactttgccagcattaggggcaagtatttggaaaatt
aaacgtcgtgtgaaatcagcaaatggaagtaagaagtccaaaaaggagtaa

DBGET integrated database retrieval system