KEGG   Streptococcus anginosus C238: SANR_0996Help
Entry
SANR_0996         CDS       T02829                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sanc  Streptococcus anginosus C238
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SANR_0996 (tdk)
Enzymes [BR:sanc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SANR_0996 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1026985..1027632
Genome map
AA seq 215 aa AA seqDB search
MSEYGKIRSIKNWRIWNELKKMAQLYYKYGTMNSGKTIEILKVAHNYEEQGKGVVIMTSA
LDTRDGFGVVSSRIGMKRKAVAIAEDTDIFRFIQEMPEKPYCVLIDEAQFLSRRHVYDLA
RVVDELNVPVMAFGLKNDFRNELFEGSKYLLLLADKIDEIKTICQFCSKKATMVLRTTNG
KPVYEGEQIQIGGNETYIPVCRKHYFKPEIDEMKS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaatatggtaaaataagaagtattaaaaattggagaatttggaacgaattaaag
aaaatggctcagttgtattataaatatggcacgatgaattcgggcaaaacaatcgaaatt
ttaaaagtagcacacaactacgaagaacaaggcaaaggtgttgtcattatgacgagcgca
cttgatacacgtgacggtttcggcgttgtttctagtcgtattggcatgaagcgaaaagca
gttgcaatagcagaagatactgatattttccgctttattcaggaaatgcccgaaaagcct
tattgtgtattgattgatgaagcgcagttcctatctcgccgtcatgtctatgacttagcg
agagtagttgacgaattaaatgtaccagttatggcttttggcttgaaaaatgattttcgc
aatgagttatttgaaggctcgaaatatctcctgcttctagcagataaaattgatgagatt
aaaacaatttgtcaattttgctccaaaaaagcaaccatggtattaagaacaacgaatggt
aagccggtctatgaaggtgagcaaattcaaatcggtgggaatgaaacatatattcctgtc
tgtcggaagcattattttaagccagaaattgacgaaatgaagagttaa

DBGET integrated database retrieval system