KEGG   Streptococcus anginosus C1051: SAIN_0081Help
Entry
SAIN_0081         CDS       T02828                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sang  Streptococcus anginosus C1051
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sang00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAIN_0081 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAIN_0081 (adhE)
   00620 Pyruvate metabolism
    SAIN_0081 (adhE)
   00650 Butanoate metabolism
    SAIN_0081 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SAIN_0081 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAIN_0081 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAIN_0081 (adhE)
   00626 Naphthalene degradation
    SAIN_0081 (adhE)
Enzymes [BR:sang01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAIN_0081 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SAIN_0081 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
69098..71749
Genome map
AA seq 883 aa AA seqDB search
MADKKTLTPEEKKLAAEKHVDELVQKGLVALEEMRKLNQEQVDYIVAKASVAALDAHGIL
AEHAVKETGRGVFEDKATKNLFACEHVVNNMRGVKTVGVIEDDPITGLTKIAEPVGVICG
ITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAAQIVRDAAIAAGAPENCVQW
ITQPSMEATTALMNHEGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVEEFKSYHTYFVNKKEKALLEEFCFGA
KANSKNCAGAKLNPNIVGKPATWIAEQAGFKVPEGTNILAAECAEVGIKEPLTREKLSPV
IAVLKAEDTEDGLKKARQMVEFNGLGHSAAIHTKDEALAKRFGTEIKAMRIIWNSPSTFG
GIGDVYNAFIPSLTLGCGSYGHNSVGDNVSAINLLNIKKVGKRRNNMQWFKVPSKIYFER
NSIQYLQTCEGIERVMIVTDKSIEKLGFVQRVIDQLNLRKNKVTIQVFSDVEPDPDITTV
RRGVEVMRSFEPDTIIALGGGSPMDAAKGMWMFYEQPDVDFGDLVQKFMDIRKRAFKFPS
LGKKAQYIGIPTTSGTGSEVTPFAVISDKANNRKYPITDYALTPTIAIVDPALVESVPAF
IAADTGMDVLTHATEAYTSNFANDYTDGIALQTIKLVFKYLEKSVKTADPEAREKMHNAS
TMAGMAFANAFLGMSHSMAHKIGAVHHTIHGRTNAILLPYVIRYNGTRPSKTTTWPKYNY
WKADEKFQDIARMLGLPCSTPEEAVEAYAKAVYDLGVAVGIKMNFKDQGIDEKTWKDSLH
DIAVLAYEDQCSPANPRLPIVTDMEEIMADAYYGYAERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaacattaactcccgaagaaaaaaagttagctgctgaaaagcatgtt
gacgaactcgttcaaaaagggctagttgctctggaagaaatgagaaaattaaatcaagaa
caagtagactacattgttgcaaaagcttcagttgctgctcttgatgcacatggtatctta
gcagaacatgctgttaaagaaacaggtcgcggcgtctttgaagacaaagcaacaaaaaac
ctttttgcctgcgaacatgttgttaacaatatgcgtggtgttaaaactgttggtgtgatt
gaagatgatcctattacaggtttaacgaaaattgctgaaccggtcggagtaatctgcgga
atcactccaacgaccaacccaacttcaacagcgatttttaaatcattgatttcgttgaaa
acgcgtaatccaattatctttgctttccacccatctgctcaagaatcttctgctcatgcg
gcacaaatcgtacgtgatgcagcgattgcagcaggtgcacctgaaaactgtgttcaatgg
attacacagccatctatggaagcaacaacagctttgatgaaccacgaagggattgcaaca
atccttgcgactggtgggaacgccatggtaaaagctgcttattcatgcggcaaacctgct
cttggagttggtgctggtaacgttccagcttacgttgaaaaatcagcaaatatccgccaa
gcagcacatgatatcgtgatgtccaaatcatttgataatggtatggtctgtgcatctgag
caagccgtgatcattgataaagaaatctatgatgaatttgtagaagaattcaaatcttac
catacttactttgtcaacaagaaagaaaaagcgcttttggaagaattctgttttggtgca
aaagctaacagcaagaactgcgctggtgcaaaattgaacccaaatattgttggtaaacca
gctacgtggattgctgagcaagcaggattcaaagtaccagaaggtacgaatatcttggcc
gctgaatgtgcagaagttggaattaaagaaccattgactcgtgaaaaattatcacctgtt
attgcagttttgaaagctgaagatactgaagatggacttaaaaaagctcgtcaaatggtt
gaatttaatggtctaggacactcagctgctatccatacaaaagatgaagctcttgcaaaa
cgtttcggtacggaaataaaggcaatgcgtattatctggaactctccatctacttttggt
ggtatcggtgatgtatacaacgccttcattccatcattaacacttggatgtggttcatac
ggacacaactcagttggtgataacgtatcagctatcaaccttcttaacatcaagaaagta
ggaaaacgtagaaataatatgcaatggtttaaagttccttcaaaaatctacttcgaacgt
aactcaatccaataccttcaaacttgcgaaggtatcgaacgtgtcatgattgttaccgat
aaatcaattgaaaaactcggttttgtacaacgtgtgattgaccaattgaatcttcgtaaa
aacaaagtcacgattcaagtcttctcagatgttgaaccagatccagatatcacaacagtt
cgtcgtggtgttgaagtaatgcgctcgtttgaaccagatactatcattgcccttggtggt
ggctcaccaatggatgcggctaaaggtatgtggatgttctatgaacagccagacgttgac
ttcggtgacctcgttcaaaaattcatggatatccgcaaacgtgccttcaaattcccatca
cttggtaagaaagcacagtatattggtattccaacaacatctggtacaggttcagaagta
acaccgtttgcagttatctctgacaaggcaaacaaccggaaatacccaatcactgactac
gctttgacaccaaccattgcaattgttgaccctgctttggtagaatctgttccagcattt
attgctgctgacacaggtatggatgtcttgacacacgcaactgaagcttatacttctaac
tttgccaatgactatacagatggtattgctcttcaaaccatcaagttagtcttcaaatac
ttggaaaaatctgtaaaaacggctgacccagaagcccgtgaaaagatgcataatgcctct
acaatggctggtatggcctttgcaaatgccttccttggaatgagtcactcaatggcgcat
aagattggtgctgttcaccacaccattcacggacgtacaaatgctattttacttccttat
gttatccgttacaatggaactcgtccatctaaaactacaacatggcctaagtacaactac
tggaaagctgatgaaaaattccaagatattgctcgtatgctaggtcttccttgctcaaca
ccagaagaagcggttgaagcgtatgccaaagctgtttatgaccttggtgtagcggttggt
atcaagatgaactttaaagatcaaggtattgatgaaaaaacttggaaagatagcttacat
gatattgccgttcttgcttatgaagatcaatgttcaccagcaaatccacgcttgccaata
gttactgacatggaagaaattatggctgatgcctactatggctatgcagaacgtccagga
cgtcgtaaatag

DBGET integrated database retrieval system