KEGG   Streptococcus anginosus C1051: SAIN_1022Help
Entry
SAIN_1022         CDS       T02828                                 

Gene name
amy
Definition
cytoplasmic alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sang  Streptococcus anginosus C1051
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sang00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAIN_1022 (amy)
Enzymes [BR:sang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SAIN_1022 (amy)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1066634..1068082
Genome map
AA seq 482 aa AA seqDB search
MENQTLMQYFEWYLPNDGQHWNRLATDAPHLASKGIRKVWMPPAFKATSSNDVGYGIYDL
FDLGEFDQKGTVRTKYGFKEDYLNAIKALKENGIEPIADIVLNHKAAADYKERFTVIEVD
PNDRTVALSEPFEIKGWTKFTFPGRHKKYNDFEWHWYHFTGTDYDAKQNKSGIYLIQGDN
KGWADDDLVDNENGNFDYLMYADLDFKHPEVIQNLYDWADWFIETTGIHGFRLDAIKHID
SFFMRNFIRDIMAKYGEDFYVFGEFWNGDETANNDYLGSIDYRFDLVDVKLHHNLFDASR
AGADYDLRNIFEQTLVKNHPKSAVTFVDNHDTQRGQALESTVEEWFKPAAYALILLREAG
LPCVFYGDYYGIKGEFAQDSFQTVLDKLLDIRLNLAYGEQTDYFDDEHCIAWTRSGKDNG
QPIAVILTNDQANSKRMYVGENWAGKEFKDYLGNNSSAVIIEEDGWADFPVAEKSVSVWS
AQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaaacattaatgcaatattttgaatggtatctaccaaatgacggacaacat
tggaatcgtttggcaacagacgctccacatctagcttctaaaggcattcgcaaggtttgg
atgccacctgcttttaaagccactagttccaacgatgtcggctacggcatttatgattta
tttgacttaggcgagtttgaccaaaaaggaacggttcggacaaagtatggctttaaggaa
gactatttgaacgcaatcaaggcactcaaagaaaatggaattgaacccattgcagatatc
gttttaaatcacaaggcggcagcggattacaaagagagatttactgttattgaagttgac
ccaaatgatcgtacagtcgccctctctgagccttttgaaataaaaggctggaccaagttc
acattccccggtcgccataaaaaatacaatgattttgaatggcattggtaccactttaca
gggacggattatgatgctaagcaaaataaatcagggatttacctcattcaaggagacaac
aaagggtgggcagatgatgacttagttgataacgaaaatggcaattttgattatctcatg
tatgctgaccttgattttaagcacccagaagtcattcaaaacctttatgattgggcagat
tggtttatcgaaacgactggcattcatggctttaggttagacgctattaagcatatcgac
tctttctttatgagaaattttatccgtgatattatggcgaagtatggagaagatttctat
gtctttggagagttttggaatggtgatgaaactgcaaataacgattatttaggaagtatt
gactatcgttttgatctcgtagatgtcaaactgcaccacaacttatttgatgctagtcgt
gctggggcggactatgatttgcgaaatatttttgaacaaacgcttgtcaaaaatcaccct
aaatcagctgttacttttgtcgataatcacgacacacaacgtggacaagcactagaatca
actgttgaagaatggtttaaacctgctgcttatgcgcttatcttgcttcgtgaagctggg
cttccttgtgtgttctacggagattactatggtatcaaaggcgaattcgctcaagacagc
ttccaaacagttcttgataaattattagacattcggctcaacttagcttatggtgagcag
actgattattttgatgacgagcattgtatcgcttggactcgttcaggaaaagacaacgga
caaccaattgctgttattttgacaaacgatcaagctaattcaaaacgcatgtatgttggt
gaaaattgggctggtaaggagtttaaagattacttaggaaacaactcttcagccgtgata
atcgaggaagacggctgggcagatttcccagttgcagaaaaatcagttagcgtctggtct
gcgcaataa

DBGET integrated database retrieval system