KEGG   Streptococcus anginosus C1051: SAIN_1761Help
Entry
SAIN_1761         CDS       T02828                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sang  Streptococcus anginosus C1051
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sang00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1829567..1831090)
Genome map
AA seq 507 aa AA seqDB search
MKERQSGVLMHISSLPGKYGIGSFGKSAYDFVDFLVRTKQRYWQILPLGTTSYGDSPYQS
FSAFAGNTHFIDFDRLVEEGLLVKSDLEGLDFGQDPRKVDYAKVFNNRRPVLEKAVKRFL
ERGDLAAYEKFVADNASWLEVFVEYMAIKEHFDLKAWTEWPDAAVRHREASSLATYREKL
ADRLTYHRVTQYLFFKQWLELKNYANEHHIEIVGDMPIYVAADSCDVWAQPHFFKTDELG
QPTCVAGCPPDEFSATGQLWGNPIYDWKAMDEDGYSWWIERLRESFKIYDVVRIDHFRGF
ESYWEIPAGSDTAAPGKWVKGPDYALFKAVKEELGELNIIAEDLGFMTDEVIALREKTGF
PGMKVTQFAFNPESESIDSPHLAPNNSVMYTGTHDNNTVLGWYRDEIDDATREYMAQYTN
RKEYETVPHAMLRTIFASVSFMAIATMQDLLELDSSARMNYPSTIGGNWSWRMTADELDP
VIEAELYSLTKTYRRLNKKLLKKENEL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcgtcaaagtggtgttctcatgcatatttcttctcttccagggaaatacgga
atcggctcatttggaaaaagtgcttacgattttgtggattttttggtaagaacaaagcaa
cgttactggcaaattttgcctttaggcacgaccagttatggagattctccttaccaatca
ttctctgcatttgcgggaaatacacattttattgattttgatcgactggttgaagaagga
ctgcttgtaaaaagtgatcttgaaggattagactttggtcaagatccaagaaaagtagat
tatgcgaaagtgtttaacaatcgcaggcctgttttggaaaaagctgtgaaacgtttctta
gaacgtggagacttagcagcctatgaaaaatttgtagcagataatgcgtcttggcttgaa
gtatttgttgaatacatggcgattaaagagcatttcgacttgaaagcttggactgaatgg
ccagatgcagcggtacgtcatcgtgaagcgtctagcttggcaacttatcgcgaaaagcta
gctgatcgattgacctatcatcgtgttacgcaatatctcttcttcaaacaatggttagaa
ttgaaaaattatgctaacgaacatcatattgaaatcgttggcgatatgccaatctatgtg
gcagctgatagctgtgatgtttgggcgcaaccgcatttctttaaaacagatgaattagga
cagcctacatgtgtagcaggatgtccgccagatgaattctctgcgaccggtcaactttgg
ggaaacccaatttatgactggaaggcaatggatgaagatgggtatagctggtggattgaa
cgcttacgtgagagtttcaaaatctacgatgtggttcgtatcgatcattttcgtggtttt
gaatcttattgggaaatccctgctggatccgatacagccgctcctggtaaatgggtgaaa
ggtcctgattatgctttgtttaaagctgtgaaggaagaattgggtgaactaaacatcatc
gccgaggacttaggctttatgaccgacgaagtgattgctttgcgggaaaaaacaggcttc
cctggtatgaaagtcactcaattcgcctttaatccagagtctgaaagtattgatagtcca
catcttgcgcctaacaattctgtcatgtacacaggtacgcatgataataacacggtactt
ggttggtatcgcgatgaaattgatgatgccacacgtgaatatatggctcaatatactaat
cgtaaagaatatgaaacagttcctcatgcaatgttacgaactatctttgcttctgtcagc
tttatggcaattgcaaccatgcaagatttattagagttagacagttcagctcgtatgaac
tatccatcaactatcggtggcaattggtcatggcgtatgacagcagatgaattggacccc
gtgattgaagcagagttatacagcttgacgaaaacatatcgtcgtttaaataaaaaatta
ttaaagaaagagaatgaattgtaa

DBGET integrated database retrieval system