KEGG   Sinocyclocheilus anshuiensis: 107671140Help
Entry
107671140         CDS       T04917                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107671140
Peptidases [BR:sanh01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   107671140
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107671140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 382 aa AA seqDB search
MRKRKTSADHDSSFTGTLLEGSSDLKQCHKKTDAASDPGGSGTAMGRRYRRGGLMWRLRK
ILIWVLGIYITIPVIIKVCPSIQAKLVFLNFVRVPYFIDLKRPQDQGLNHTRNFYLQPEE
GINIGVWHTVPSVMWREAQAKDAEWYDKSFQSSHPVILYLHGNAGTRGGDHRVQLYKVLC
SLGYHVVTFDYRGWGDSEGSPSEKGMTSDALFLYQWIKQRIGQKPLYIWGHSLGTGVATN
LVRRLCDRGMPPDSLILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDSITANDIRFAS
DENVNHISCPVLILHAEDDAVVPFQLGKKLYDLAAQSKSLNGHKVQFIPFPSSLGYRHKF
IYKSPQLPNILSDFLSAPHPHV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagcgaaaaaccagcgcagaccatgacagctcgttcacgggtacactactggaa
ggcagctccgatctaaagcagtgccacaaaaagacagacgctgcttctgatccaggaggt
tcggggacagcgatggggagacgctacaggaggggtggtctaatgtggaggctgaggaag
atactgatctgggtgctgggaatctacatcaccatccctgttatcatcaaagtctgtcca
tcaatacaagcaaaattagtatttttaaactttgtgcgagtgccatattttatagatctg
aagcgaccacaggatcagggcttgaatcacactcgcaatttctacctgcagcccgaggag
ggaatcaacattggagtgtggcacacagtgccttcagtgatgtggagggaggctcaggca
aaagatgctgaatggtatgacaaaagcttccagtccagtcatcctgtcatcctgtatctc
catggaaacgctggaacaagaggaggggatcacagagttcagctgtacaaggttctttgt
tcattaggctaccatgtagtcacatttgattatagaggttggggtgactctgagggaagc
ccttcagagaaaggcatgacatcagacgctctcttcctctaccagtggataaagcagcgg
attggccagaagcccctgtacatatggggtcactcgctcggcacaggagtggccactaac
ctagtgagacggctctgtgacaggggaatgcccccagactccctaattttagagtcacca
tttaccaatatcagagaggaagccaagagccatcccttctctatggtttacagatatcta
ccaggctttgactggttcttcctggattctataactgcaaatgacattcgttttgccagt
gacgagaatgtcaaccacatatcctgtccggttctgatcctgcatgcagaagatgacgct
gttgtacccttccagcttggaaagaagctgtatgatttggcagctcagagcaagagtctg
aacggtcataaggttcagttcatcccattccccagctctctgggctacagacacaagttc
atctacaagagcccacagctaccaaatatactcagtgattttctcagtgcgccgcatcct
cacgtgtag

DBGET integrated database retrieval system