KEGG   Sinocyclocheilus anshuiensis: 107671974Help
Entry
107671974         CDS       T04917                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107671974
Peptidases [BR:sanh01002]
 Serine Peptidases
  Family S33
   107671974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 339 aa AA seqDB search
MDRDMANMFAIAAGTLAIPLLLFMASFMLWPSSLIKVYYWYWRRTLGLRVRYADCGGYRF
CYSYRGKPGLRPSVLMLHDFSAHKDTWLPMVKYLPKHLHLLCVDMPGHEGTTRTNTDDYS
IQGQVKRIRQFVEAIRLNRKPFHLVGTSMGGTVAGVYAAYHPSVLCGLTIICPVGLKNQM
ESQFDSQMHEVEHSQYTLNIPLIPSTPEEMEEMLKLCSHVRFRVPQQILQGLVDVRIPHN
DFYHEVFMEIMSENSKYALHEHIQQITTPLQVIWGKQDQVVDVSGAAVLKEALPGCRVDL
LENCGHSVVMERPRQTAKLILDFINSQQSTESTSTKKKS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggatcgggatatggccaatatgtttgccattgctgcagggactcttgctatccctctc
ctccttttcatggcctcttttatgctgtggccatcatcactcatcaaagtctattactgg
tactggaggagaactctgggtctgcgggtacgttatgcagactgcgggggttatcgcttc
tgttactcatacagggggaaaccaggcctcaggccttctgtactcatgctgcatgacttc
tctgctcacaaggacacatggcttcctatggtgaagtaccttcccaaacatctgcactta
ctatgtgttgacatgccgggacatgagggtacaacacgtaccaacaccgacgactattca
atccaaggccaggtcaagagaatacggcagtttgtagaggccattcggctaaacaggaag
ccattccatctggtgggcacttcaatgggtgggactgtggccggagtgtatgcagcctat
catccctcagttctctgcggtttgaccatcatctgcccagtcggtctaaagaaccaaatg
gagagccagtttgacagtcagatgcatgaagtggagcacagccagtacacgctgaatatt
cctcttattccgtccaccccagaggagatggaggagatgctgaagctctgttctcacgtg
cgcttcagagtgcctcaacagattctacaaggcctcgtggatgtacggataccacacaat
gacttttatcatgaagttttcatggaaattatgagtgaaaattcaaaatatgccttgcat
gagcatatacagcaaataactacccctttacaagtcatctggggcaaacaggaccaggtg
gtggatgtgtctggggcagcggtgctcaaggaggctcttccaggctgtcgtgttgatctg
ctggagaactgcggtcattctgttgtaatggagcgaccacgacaaacagccaaactcatt
ttagatttcatcaattctcagcagagcacagagagcaccagcaccaaaaagaaatcctga

DBGET integrated database retrieval system