KEGG   Sinocyclocheilus anshuiensis: 107679569Help
Entry
107679569         CDS       T04917                                 

Definition
(RefSeq) monoglyceride lipase-like isoform X1
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:sanh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    107679569
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107679569
Peptidases [BR:sanh01002]
 Serine Peptidases
  Family S33
   107679569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 343 aa AA seqDB search
MNEIPGMHMLATCLLVAAVSYWYSSELLTALRLFISDSALGGDMPEPEGNRLSPQGVPYT
DLPHIVNADGLHLFCRYWKPDSQPKALVFVTHGAGEHCGGYADIAHSLTQHGIMVFAHDH
VGHGQSEGERMDIKNFQIYIRDALQHIDIMKGRYPNMPVFIIGHSMGGSISILTACERPQ
DFAGVVLIGPMVQMNAESATPFKVFLAKILNRLTPKLSLGSIESKWVSRDPKQVEAYDTD
ELNYHGGLRVSFGMQLMDAAARIKRELPSITWPFFILHGDADKLCDIGGSHLMYNEAKST
DKKLKVYEKAYHALHHDLPETAESVLKEVSTWILERLPSPHGS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaattcccggaatgcatatgctagccacctgcctattagtcgctgctgtttca
tactggtacagcagcgagcttctgacagcgcttcgtctgtttatttcagactcagccctc
ggcggggacatgccggaacccgaggggaatcgtctgtcaccgcaaggtgtcccttacacc
gacctgccgcacatcgtcaacgccgacggactgcacctgttctgccgttactggaagccc
gacagtcagccaaaggcgctggtgtttgttacccacggagcaggagagcactgtggggga
tatgctgacattgctcacagcctgacccagcatggtattatggtgttcgcccacgatcac
gttggtcatggccagagtgaaggtgagagaatggatatcaaaaactttcaaatttacatc
agagatgccctccagcacattgacatcatgaagggccggtaccccaatatgccagtcttc
atcattggacactcaatgggagggagcatttccattctgaccgcatgtgagaggccgcag
gattttgcaggtgtggttctcataggccccatggttcaaatgaatgctgaatctgctaca
cctttcaaggttttcctggcaaaaattctaaaccgcttgactcccaaactctctcttggt
tcgatcgaatcaaaatgggtgtcacgggatcccaaacaggtggaggcatatgacacagat
gagctaaattatcatggagggctgcgcgtctcgttcggaatgcagctgatggatgcggcg
gctcgcatcaagagagaattacccagcattacatggcccttcttcattctccatggagac
gccgacaagctttgtgacatcggaggctctcatctaatgtataatgaggccaagagcact
gataaaaaactgaaggtgtatgaaaaagcctaccatgccctacatcatgacttacctgaa
acagctgagtctgtcttaaaggaggtgagcacttggatcctggagagactccccagccct
catgggtcttag

DBGET integrated database retrieval system