KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00634Help
Entry
SAOUHSC_00634     CDS       T00324                                 

Definition
ABC transporter substrate-binding protein
Orthology
K11704  
iron/zinc/copper transport system substrate-binding protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
ABC transporters
Module
Iron/zinc/copper transport system
Brite
KEGG Orthology (KO) [BR:sao00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SAOUHSC_00634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(624572..625510)
Genome map
AA seq 312 aa AA seqDB search
MKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDMAKNVGGDNVDIHSIV
PVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALEQAGKSLKDKKVIAVSK
DVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDNDKKHKADYEKQGNKYIAQ
LEKLNNDSKDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGYIWEINTEKQGTPEQM
RQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTDSIGKEGTKGDSYYKMM
KSNIETVHGSMK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagtacctttattattagccttattacttctagttgctgcatgtggtact
ggtggtaaacaaagcagtgataagtcaaatggcaaattaaaagtagtaacgacgaattca
attttatatgatatggctaaaaatgttggtggagacaacgtcgatattcatagtattgta
cctgttggtcaagatcctcatgaatatgaagttaaacctaaagatattaaaaagttaact
gacgctgacgttattttatacaacggattaaatttagagactggtaacggttggtttgaa
aaagccttagaacaggctggtaaatcattaaaagataaaaaagttatcgcagtatcaaaa
gatgttaaacctatctatttaaacggtgaagaaggcaacaaagataaacaagatccacac
gcatggttaagtttagataacggtattaaatacgtaaaaacaattcaacaaacatttatc
gataacgacaaaaaacataaagcagattatgaaaagcaaggtaacaaatacattgctcaa
ttggaaaaattaaataatgacagtaaagacagtaaagacaaatttaatgacattccaaaa
gaacaacgtgccatgattacaagtgaaggtgccttcaagtacttctcaaaacaatacggt
attacaccaggttatatttgggaaattaacactgaaaaacaaggtacacctgaacaaatg
agacaagctattgagtttgttaaaaagcacaaattaaaacacttattagtagaaacaagt
gttgataagaaagcaatggaaagtttatctgaagaaacgaagaaagatatctttggtgaa
gtgtacacagattcaatcggtaaagaaggcactaaaggtgactcttactacaaaatgatg
aaatcaaatattgaaactgtacacggaagcatgaaataa

DBGET integrated database retrieval system