KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00765Help
Entry
SAOUHSC_00765     CDS       T00324                                 

Definition
(RefSeq) hypothetical protein
  KO
K02240  competence protein ComFA
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Module
sao_M00429  Competence-related DNA transformation transporter
Brite
Secretion system [BR:sao02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   SAOUHSC_00765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C ResIII DEAD PrpR_N Helicase_RecD Flavi_DEAD Glyco_hydro_70 AAA_24
Motif
Other DBs
NCBI-GeneID: 3919057
NCBI-ProteinID: YP_499323
UniProt: Q2G057
Position
747288..748226
Genome map
AA seq 312 aa AA seqDB search
MLYAVTGAGKTEMMFQGIQYARIQGDNIAIVSPRVDVVVEISKRIKDAFLNEDIDILHQQ
SRQQFEGHFVVCTVHQLYRFKQHFDTIFIDEVDAFPLSMDKNLQQALKSSSKVEHATIYM
TATPPKQLLSEIPHENIIKLPARFHKKSLPVPKYRYFKLNNKKIQKMLYRILQDQINNQR
YTLVFFNNIETMIKTFSVYKQKITKLTYVHSEDVFRFEKVEQLRNGHFDVIFTTTILERG
FTMANLDVVVIDAHQYTQEALIQIAGRVGRKLECPTGKVLFFHEGVSMNMIQAKKEIQRM
NKLALKRGWIDE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgttatatgccgtaacaggtgcaggtaagacagaaatgatgtttcaaggcattcaatat
gcaagaatacagggagataatatagctattgtgtcaccacgtgtagatgttgttgtagaa
attagtaaacgtattaaagacgcatttcttaatgaagatatagacatactacaccagcaa
tcaagacaacaatttgaagggcattttgttgtatgcacagtgcatcaactttaccgattc
aaacagcactttgatactatttttattgatgaagtcgatgcctttcctttatcaatggat
aaaaatttacaacaagcattgaagtcatcttctaaagttgaacatgcaacaatttatatg
acagcaacaccaccgaaacaacttctgtcagagattccccacgaaaatataattaaattg
ccagctcgctttcataaaaaatcacttccagttcctaaatatcgttatttcaaacttaat
aataagaagattcagaaaatgttataccgaattttacaagatcaaattaataatcaacgt
tatacactggtgttttttaacaatatagaaacaatgattaaaacattttcggtttataag
cagaaaattactaaattaacatacgtccatagcgaggatgtttttcgctttgaaaaagtt
gaacaattaaggaatggacatttcgatgtcatttttactacgacaatattagaacgtgga
tttacaatggcaaatttggatgttgttgttatcgatgcacatcaatatactcaagaggct
ttaatacaaattgctggacgtgttggacgaaaattagaatgtcctactggaaaagtattg
ttttttcatgaaggggtaagtatgaatatgattcaagctaaaaaagagattcaaaggatg
aacaaattagcattaaaaagaggttggattgatgaataa

DBGET integrated database retrieval system