KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_00765Help
Entry
SAOUHSC_00765     CDS       T00324                                 

Definition
hypothetical protein
Orthology
K02240  
competence protein ComFA
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Module
Competence-related DNA transformation transporter
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
747288..748226
Genome map
AA seq 312 aa AA seqDB search
MLYAVTGAGKTEMMFQGIQYARIQGDNIAIVSPRVDVVVEISKRIKDAFLNEDIDILHQQ
SRQQFEGHFVVCTVHQLYRFKQHFDTIFIDEVDAFPLSMDKNLQQALKSSSKVEHATIYM
TATPPKQLLSEIPHENIIKLPARFHKKSLPVPKYRYFKLNNKKIQKMLYRILQDQINNQR
YTLVFFNNIETMIKTFSVYKQKITKLTYVHSEDVFRFEKVEQLRNGHFDVIFTTTILERG
FTMANLDVVVIDAHQYTQEALIQIAGRVGRKLECPTGKVLFFHEGVSMNMIQAKKEIQRM
NKLALKRGWIDE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgttatatgccgtaacaggtgcaggtaagacagaaatgatgtttcaaggcattcaatat
gcaagaatacagggagataatatagctattgtgtcaccacgtgtagatgttgttgtagaa
attagtaaacgtattaaagacgcatttcttaatgaagatatagacatactacaccagcaa
tcaagacaacaatttgaagggcattttgttgtatgcacagtgcatcaactttaccgattc
aaacagcactttgatactatttttattgatgaagtcgatgcctttcctttatcaatggat
aaaaatttacaacaagcattgaagtcatcttctaaagttgaacatgcaacaatttatatg
acagcaacaccaccgaaacaacttctgtcagagattccccacgaaaatataattaaattg
ccagctcgctttcataaaaaatcacttccagttcctaaatatcgttatttcaaacttaat
aataagaagattcagaaaatgttataccgaattttacaagatcaaattaataatcaacgt
tatacactggtgttttttaacaatatagaaacaatgattaaaacattttcggtttataag
cagaaaattactaaattaacatacgtccatagcgaggatgtttttcgctttgaaaaagtt
gaacaattaaggaatggacatttcgatgtcatttttactacgacaatattagaacgtgga
tttacaatggcaaatttggatgttgttgttatcgatgcacatcaatatactcaagaggct
ttaatacaaattgctggacgtgttggacgaaaattagaatgtcctactggaaaagtattg
ttttttcatgaaggggtaagtatgaatatgattcaagctaaaaaagagattcaaaggatg
aacaaattagcattaaaaagaggttggattgatgaataa

DBGET integrated database retrieval system