KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01142Help
Entry
SAOUHSC_01142     CDS       T00324                                 

Definition
cell division protein MraZ
Orthology
K03925  
MraZ protein
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1092096..1092527
Genome map
AA seq 143 aa AA seqDB search
MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGLDKCLFGYTLDEWQQIEEKMKTLPM
TKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIWDRETW
NDFYEESEESFEDIAEDLIDFDF
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgttcatgggagaatacgatcatcaattagatacaaaaggacgtatgattataccgtcc
aagtttcgttatgacttaaatgagcgttttattatcacaagaggccttgataaatgttta
ttcggttacactctagacgaatggcaacagattgaagagaaaatgaaaaccttacctatg
acaaaaaaagacgcacgtaagtttatgcgtatgttcttctctggtgctgttgaagtagaa
cttgataagcaagggcgtattaacatccctcaaaacttgaggaaatacgctaatttaact
aaagaatgtacagtaatcggtgtttcaaatcgtattgagatttgggatagagaaacttgg
aatgatttctatgaagaatctgaagaaagtttcgaagatattgctgaagatttaatagat
tttgatttttaa

DBGET integrated database retrieval system