KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01371Help
Entry
SAOUHSC_01371     CDS       T00324                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sao01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sao00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sao00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1314819..1316033
Genome map
AA seq 404 aa AA seqDB search
MNKQIQTEADELGFFGEYGGQYVPETLMPAIIELKKAYKEAKADPEFQRELEYYLSEYVG
RATPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKA
LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
GSNAIGTFYPFIKDDVALYGVEAAGQGDDTDKHALAIGKGSPGVLHGTKMYLIQDEDGQV
QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
LSYVERLAPTMSKEDIIVVTISGRGDKDMETIRQYMVERGLAND
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaatacaaacagaagcagatgaattaggtttctttggtgaatatggaggg
caatatgttccagaaacattaatgccagcaattattgagttgaaaaaagcttataaagag
gcaaaagcagacccagagtttcaaagagaactggaatactatttatcagagtatgtagga
cgcgcgacaccacttacatatgctgcatcatatactgaaagcctaggtggcgctaaaata
tatttgaaacgagaggatctaaatcatacaggcgcccataaaattaataatgcgttaggt
caagcgttgcttgctaaaagaatgggcaagaagaagcttgttgctgaaactggtgcgggt
caacatggtgtagctagtgctacggttgctgcattatttgatatggaacttgttgtcttt
atgggaagtgaagatattaaaagacaacaacttaatgtatttagaatggaattacttggt
gcaaaggttgtggcagttgaagatggtcaagggactttatcggatgcagttaataaagca
ttgcaatattgggtaagtcatgtagatgatacacattatttattaggttctgcattaggt
ccagacccgttcccaacgattgttagagattttcagagtgtgattggtaaagaaataaaa
tcacagatattgaagaaagaaggtcgacttccggatgcaattgtagcatgtatcggtggt
ggctcaaatgcaatcggtacattttatccatttattaaagatgatgttgcattatacggt
gttgaagccgcaggtcaaggcgatgatactgataaacatgcacttgcaattggcaaagga
tcacctggcgtattacatggtactaaaatgtatttaattcaagatgaagatgggcaagtg
caactagcacattctatttcagcaggacttgattatcctggtattggaccagaacattct
tattaccacgacattggtagagtaacttttgaaaatgctagtgatacacaagcaatgaat
gctttaatcaactttacaaaacatgaaggtattatacctgcaattgaaagtgcacatgca
ctgagttatgttgaaagactagcgcctacgatgtcgaaagaagatattattgtagtaact
atttctggacgtggcgataaagatatggaaacaattagacaatatatggtagagcgaggt
cttgcaaatgactaa

DBGET integrated database retrieval system