KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01646Help
Entry
SAOUHSC_01646     CDS       T00324                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00010  Glycolysis / Gluconeogenesis
sao00052  Galactose metabolism
sao00500  Starch and sucrose metabolism
sao00520  Amino sugar and nucleotide sugar metabolism
sao00521  Streptomycin biosynthesis
sao01100  Metabolic pathways
sao01110  Biosynthesis of secondary metabolites
sao01120  Microbial metabolism in diverse environments
sao01130  Biosynthesis of antibiotics
sao01200  Carbon metabolism
Module
sao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sao_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAOUHSC_01646
   00052 Galactose metabolism
    SAOUHSC_01646
   00500 Starch and sucrose metabolism
    SAOUHSC_01646
   00520 Amino sugar and nucleotide sugar metabolism
    SAOUHSC_01646
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAOUHSC_01646
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SAOUHSC_01646
Enzymes [BR:sao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAOUHSC_01646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-GeneID: 3920098
NCBI-ProteinID: YP_500158
UniProt: Q2FY27
Position
complement(1561291..1562277)
Genome map
AA seq 328 aa AA seqDB search
MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTSDSTGYTLLKGIYDSFVEKVNENN
YNFSNVLGVGIGVPGPVDFEKGTVNGAVNLYWPEKVNVREIFEQFVDCPVYVDNDANIAA
LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
GRSGCIETVASATGVVNLVNFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFAPAQFETEIV
QAKLGNDAGITGAAGLIKTYVLDKEGVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattattttagcagctgatgtaggcgggacgacttgtaaattaggtattttc
acacctgaattagaacaattacataaatggtctattcacactgatacatctgatagtaca
ggatatacacttttgaaaggaatttatgattcgtttgttgaaaaagtaaatgaaaataat
tataatttttcaaatgtacttggcgtaggtattggtgtaccaggtcctgttgactttgaa
aaaggtacagtaaatggagcagtaaacttatattggccagaaaaagttaatgtacgtgag
atttttgaacaattcgttgattgtccagtgtatgtagataatgatgctaacatagctgct
ttaggggagaaacacaaaggtgctggtgaaggtgccgatgatgttgttgccatcacactt
ggtacaggtctaggtggaggaattatttcaaatggtgaaatcgtacatggtcataatggc
tctggcgcagaaataggtcattttagagcagacttcgatcaacgatttaaatgtaattgt
ggtcgttctggatgtattgaaacagttgcttcagcgacaggcgttgttaacttagttaac
ttctactatccgaagttgacgtttagatcttctatattagaattgattaaagaaaataag
gttacagcaaaagctgtttttgatgcggcaaaagctggtgaccaattctgtattttcatt
actgaaaaggttgcaaactatattggatatttatgtagtattattagtgttacaagtaat
ccgaaatatatcgttctaggtggaggaatgtctactgcaggacctattttaattgaaaat
attaaaacagaatatcataatttaacatttgcacctgctcaatttgaaactgaaattgta
caagcgaaattaggtaatgatgcaggtattacaggagcagcaggattaatcaagacctat
gtattagataaagagggggtaaaataa

DBGET integrated database retrieval system