KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01773Help
Entry
SAOUHSC_01773     CDS       T00324                                 

Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAOUHSC_01773
Enzymes [BR:sao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SAOUHSC_01773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1673072..1673740)
Genome map
AA seq 222 aa AA seqDB search
MKPVVVMTQTNDMQSDLVSIIHKPFIDIKPLNFDIHLLNQRYDWLIFSSKNAVKFFYKYL
KGINVDNIAVIGSKTAQYCESLGIRVDFMPNDFSQEGFLKSFNQTNQKILLPSSELARPL
LLAALSKDNEVVKIDLYTSVPNKQNIQDVKEMIEHQQIDALTFSSSSAVRYYFNEGFVPK
FKSYFAIGEQTARTIKSYQQPVTIAEIQTLESLIEKILESRG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagttgtagttatgacacaaacaaatgacatgcaaagtgatttagtatcaatt
attcacaaaccctttattgatataaagccactaaattttgatattcatttgttaaatcaa
cgctatgactggcttattttttcatctaaaaatgctgtgaaattcttttataaatatcta
aaaggaattaatgttgataacattgctgtgataggaagtaagacagcgcaatattgtgaa
tcacttggcattcgagttgattttatgccaaacgacttttctcaagaaggatttttaaaa
tcatttaatcaaactaaccaaaaaatacttttgccttcgagtgaattggcgagaccattg
ttattagcagcgttatctaaagataatgaagttgttaaaatagatttatatacttcagtg
cctaacaaacaaaatatacaagatgttaaagaaatgatagaacatcaacaaatcgatgca
ttaacattttcaagttcgtcggcagtacgttattattttaatgaaggatttgtaccaaaa
ttcaagtcgtattttgctattggagaacaaacagcacggaccattaaatcatatcaacaa
ccagtaacaattgcagaaattcaaacactcgaatcactaattgaaaagattttagaaagt
aggggctaa

DBGET integrated database retrieval system