KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01807Help
Entry
SAOUHSC_01807     CDS       T00324                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:sao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAOUHSC_01807
   01230 Biosynthesis of amino acids
    SAOUHSC_01807
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAOUHSC_01807
   00030 Pentose phosphate pathway
    SAOUHSC_01807
   00051 Fructose and mannose metabolism
    SAOUHSC_01807
   00052 Galactose metabolism
    SAOUHSC_01807
  Energy metabolism
   00680 Methane metabolism
    SAOUHSC_01807
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SAOUHSC_01807
Enzymes [BR:sao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SAOUHSC_01807
Protein phosphatases and associated proteins [BR:sao01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SAOUHSC_01807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1709745..1710668)
Genome map
AA seq 307 aa AA seqDB search
MNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYSARCPE
FKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQTIGIPGTIDNDINGT
DFTIGFDTALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPE
VKTDIKEIADKIEQGIKRGKKHSIVLVAEGCMTAQDCQKELSQYINVDNRVSVLGHVQRG
GSPTGADRVLASRLGGYAVDLLMQGETAKGVGIKNNKIVATSFDEIFDGKDHKFDYSLYE
LANKLSI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgccgtaagagcagttgttcgtacagcaatttacaatgaaattgaagtttat
ggtgtgtatcatggttaccaaggattgttaaatgatgatattcataaacttgaattagga
tcagttggggatacgattcagcgtggaggtacattcttgtattcagcaagatgtccagag
tttaaggagcaagaagtacgtaaagttgcaatcgaaaacttacgtaaaagagggattgag
ggccttgtagttattggtggtgacggtagttatcgcggtgcacaacgcatcagtgaggaa
tgtaaagaaattcaaactatcggtattcctggtacgattgacaatgatatcaatggtact
gattttacaattggatttgacacagcattaaatacgattattggcttagtcgacaaaatt
agagatactgcgtcaagtcacgcacgaacatttatcattgaagcaatgggccgtgattgt
ggagatctagcattatgggctggattatcagttggtgctgagacaattgtagttccagaa
gtgaaaacagatattaaagaaatagctgataaaattgaacaaggtattaaacgtggtaag
aaacactcaatcgttcttgtagcagaaggttgtatgactgcgcaagattgtcaaaaagaa
ttatcacaatacatcaatgttgataatagagtgtctgtgttaggtcacgttcaacgtggt
ggtagcccaacaggtgcggatagagttttagcatcacgtttaggtggatatgcggtagac
ttattaatgcaaggtgaaacagctaagggtgttggaattaagaacaataaaattgtagca
acatcttttgatgaaatttttgatggtaaagatcataaatttgattatagtctatatgaa
cttgctaacaagttatctatataa

DBGET integrated database retrieval system