KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_01960Help
Entry
SAOUHSC_01960     CDS       T00324                                 

Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
sao00860  Porphyrin and chlorophyll metabolism
sao01100  Metabolic pathways
sao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAOUHSC_01960
Enzymes [BR:sao01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SAOUHSC_01960
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SAOUHSC_01960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 MCRA Pyr_redox Thi4 HI0933_like NAD_binding_9 FAD_binding_2 Mqo FAD_binding_3 Glu_dehyd_C Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 3920905
NCBI-ProteinID: YP_500459
UniProt: Q2FXA5
Position
complement(1866403..1867803)
Genome map
AA seq 466 aa AA seqDB search
MTKSVAIIGAGITGLSSAYFLKQQDPNIDVTIFEASNRPGGKIQSYRKDGYMIELGPESY
LGRKTIMTELAKDIGLEQDIVTNTTGQSYIFAKNKLYPIPGGSIMGIPTDIKPFVTTKLI
SPLGKLRAGFDLLKKPTQMQDGDISVGAFFRARLGNEVLENLIEPLMGGIYGTDIDKLSL
MSTFPNFKEKEEAFGSLIKGMKDEKNKRLKQRQLYPGAPKGQFKQFKHGLSSFIEALEQD
VKNKGVTIRYNTSVDDIITSQKQYKIVYNDQLEEVYDGVLVTTPHQVFLNWFGQDPAFDY
FKTMDSTTVATVVLAFDEKDIENTHDGTGFVIARTSDTDITACTWTSKKWPFTTPEGKVL
IRAYVGKPGDTVVDDHTDNELVSIVRRDLSQMMTFKGDPEFTIVNRLPKSMPQYHVGHIQ
QIRQIQAHIKQTYPRLRVTGASFEAVGLPDCITQGKVAAEEVIAEL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaatcagtggctattataggagcggggataacaggtttatcaagtgcatatttt
ttaaaacagcaagatcctaatattgatgtaaccatctttgaagcatcgaatcgtccgggg
ggaaagattcaatcgtatcgtaaagatggttatatgattgaactagggcctgaatcttat
ttaggtagaaaaacgattatgacagaattagcgaaagatattggattagaacaagatatt
gttacaaatacgactggacaatcatatatttttgcgaaaaataaattatatccgattcca
ggtggttcaattatgggtattccaacagatattaaaccatttgttactacaaaattaata
tcgccacttggtaaattaagagcagggtttgatttattaaaaaaacctactcaaatgcag
gatggtgacatttctgttggtgcatttttcagagcaagattaggtaatgaggtacttgag
aatttaatagagcctttaatgggtggtatttatggtaccgatattgataaattaagtttg
atgagtacgtttcctaattttaaagaaaaagaagaggcattcggaagtctgataaaaggt
atgaaggatgagaaaaataagcgtctgaaacaaagacaattatatcctggcgcaccgaaa
ggacaattcaaacaatttaagcatggtttaagctcatttattgaagcattagaacaagat
gttaaaaataaaggtgtgacaatacgctacaatacgtcagtggatgatataattacatct
caaaaacaatataaaattgtttacaatgatcaactagaagaagtgtatgatggcgtatta
gtaacgacaccacatcaagtgtttttaaattggttcggacaagatccagcatttgattac
tttaaaacgatggatagtacgactgttgcaactgttgtattggcatttgatgaaaaagac
attgaaaatacccatgatggtactggcttcgtaattgcgagaacgagtgatacagacatt
accgcatgtacttggacatcgaaaaaatggccatttactacaccggaaggtaaggttttg
attcgtgcgtatgtaggtaaaccaggtgatactgtggttgatgatcatacagataatgaa
ttagtatcgattgtacgtagagatttaagtcaaatgatgacatttaaaggtgatcctgaa
tttacaattgtcaatcgtttgccgaaaagtatgccacagtaccatgtcggtcatattcaa
caaattagacagattcaagcacatattaaacaaacatatccacgacttagagtaactggt
gcatcttttgaagcggttggactacctgattgtattacgcaaggtaaagttgctgctgaa
gaagtaatcgcagagttgtaa

DBGET integrated database retrieval system