KEGG   Staphylococcus aureus subsp. aureus NCTC8325: SAOUHSC_02801Help
Entry
SAOUHSC_02801     CDS       T00324                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sao  Staphylococcus aureus subsp. aureus NCTC8325
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sao00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sao00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sao00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sao00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2576833..2577615)
Genome map
AA seq 260 aa AA seqDB search
MLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQKELEMVLKEKGKSELLE
KVQYSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVPAVKQLIDV
YEETGHSVIGVQEVPEADTHRYGIIDPLTKNGRQYEVKKFVEKPAQGTAPSNLAIMGRYV
LTPEIFDYLKTQKEGAGNEIQLTDAIERMNNDNQVYAYDFEGERYDVGEKLGFVKTTIEY
ALKDDSMREELTRFIKALGL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctatcttagataaacccacaatacaatatatcgttgaagaagctgcaagagct
ggaattgaagatattattatagtgacaggtcgccacaaacgcgcgattgaagatcatttt
gatagtcaaaaagaattagaaatggtgttaaaagaaaaaggtaaatctgaattactagag
aaagttcagtattcaacggaacttgcgaatattttttatgtaaggcagaaagaacaaaaa
ggtttagggcatgcgattagttctgcgcgtcaatttatcggcaatgaaccatttgcggta
ttattaggtgacgatattgttgaatctgaagtgccagcagtgaaacagttgattgacgtt
tatgaagaaacagggcactcagttataggtgtccaagaagttccggaagcagatactcat
cgttatggaattattgacccattaactaaaaacggacgtcagtatgaagtgaaaaagttt
gttgaaaagccagcacaaggtacggcaccatcaaacctagctattatgggacgttatgta
ttaacgcctgaaattttcgattatttaaaaacgcaaaaagaaggcgcaggtaacgaaatt
cagttaacagatgcgattgaacgtatgaataatgataaccaagtgtatgcatatgacttc
gaaggcgaacgttatgacgttggagaaaaattaggcttcgttaaaactaccatagaatat
gcattgaaagatgacagtatgcgagaagaattaacacgatttattaaagcattaggttta
taa

DBGET integrated database retrieval system