KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0110Help
Entry
Sulac_0110        CDS       T01746                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulac_0110
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sulac_0110
   00630 Glyoxylate and dicarboxylate metabolism
    Sulac_0110
Enzymes [BR:sap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sulac_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
136712..138286
Genome map
AA seq 524 aa AA seqDB search
MAVDIKGPTVPGSERILTSDALTFLEDLHRTFNPRRLERLRARQEIQQRIFQGWRPDFRP
DTREIRESEWTVGTIPADLTDRRVEITGPTDRKMVINALNSGARVFMADFEDANSPTWTN
LVLGQMNLIDAIERTITFESPQGETYRLKDQVATLVVRPRGWHLPERHLTVDGEPMAGAL
VDFGLYVFHNARRLVERGSAPYLYLPKLENMEEAQLWEDVLGWAEERVGLPFGTMKVTVL
IETILAAFEMEEILWALRPHIVGLNAGRWDYLFSIIKKFRRQPDVMPADRQQITMTVPFM
RAYTELLVKTCHRRGAYAIGGMAAFIPSRRDPEINRVALAKVEDDKEREARDGFDGTWVA
HPDLVPVATAVFDRVLGPRPHQRDRQRDDVVVTADDLLDFRVPGGTMTEAGLKNNVAVAI
QYLAAWLGGSGAVGLYNLMEDAATAEIARAQVWQWITHGVRLSDGKPVTAQLVERLIQEG
LQEWGAHWPERDAAVDVFRSVALSSEWVDFLTLPAYDRLLAILH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggacatcaagggtccaacggttccgggaagcgaacgcattttaacatcggac
gcgctcacctttctggaggatttgcatcggacctttaacccgcggcggttggagcggtta
cgcgcccgtcaggaaatccaacaacgcatctttcagggatggcggccggactttcggccg
gatacccgagagatacgggaatccgaatggacggtgggaaccatacccgccgatctcacg
gatcgccgggtggaaatcaccggtccgacggatcgcaaaatggtgattaatgccctgaat
tccggggctcgggtctttatggccgacttcgaagacgcgaacagtccgacttggaccaac
ctggttttgggtcagatgaacttaatcgacgcgattgagcggacgattacgttcgaatcg
cctcagggggagacataccgcttaaaggatcaggtggccaccttggtggtgcgaccgcgg
ggatggcatttgcccgagcggcatctgacggtagacggtgaaccgatggcgggagccttg
gtcgatttcggactgtacgtgtttcacaacgcccgccgactggtggaacgagggagtgcc
ccctatttatatttgccgaaactcgaaaacatggaagaagcccagttgtgggaagacgtg
ctcggctgggcggaggagcgggtggggcttcccttcggcaccatgaaagtgacggtactg
attgaaaccattttagcggcttttgaaatggaagagattttgtgggccttgcgtccgcac
attgtgggattgaatgcgggccgctgggactatctgttcagcattattaagaaattccgt
cgccaaccggacgtcatgccggccgaccggcagcaaattaccatgaccgtgccgtttatg
cgggcatacaccgaacttttggtcaaaacctgtcatcggcggggggcttatgccattgga
ggcatggcggcatttatcccgagccgccgggatccggagattaaccgcgtggcgctggcg
aaagtcgaggacgacaaagagcgggaagcgcgtgacggattcgacgggacctgggtggcc
catcccgacctcgtgccggttgcgaccgccgtttttgaccgggtgctggggccgcgtcct
catcaacgcgaccgccaacgggacgatgtggtcgtaaccgccgacgatttactggatttc
cgggtacccggaggcaccatgaccgaggcgggactgaaaaataatgtggcggttgccatc
caatacttggcggcttggctcggcggttcgggggcggtggggctttataacctgatggag
gatgcggcgaccgcggaaattgcccgggcccaagtgtggcagtggattacccatggcgtg
cggttgtccgacggtaagccggtgacggcccaactggtggaacggttaattcaagaaggc
cttcaggaatggggagcccattggcccgaacgggatgcggcggtggacgttttccggtcg
gtcgccttgtcgtccgaatgggtcgattttctcacattgccggcctatgaccgcctgtta
gcgattttacattaa

DBGET integrated database retrieval system