KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0110Help
Entry
Sulac_0110        CDS       T01746                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulac_0110
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sulac_0110
   00630 Glyoxylate and dicarboxylate metabolism
    Sulac_0110
Enzymes [BR:sap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sulac_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
136712..138286
Genome map
AA seq 524 aa AA seqDB search
MAVDIKGPTVPGSERILTSDALTFLEDLHRTFNPRRLERLRARQEIQQRIFQGWRPDFRP
DTREIRESEWTVGTIPADLTDRRVEITGPTDRKMVINALNSGARVFMADFEDANSPTWTN
LVLGQMNLIDAIERTITFESPQGETYRLKDQVATLVVRPRGWHLPERHLTVDGEPMAGAL
VDFGLYVFHNARRLVERGSAPYLYLPKLENMEEAQLWEDVLGWAEERVGLPFGTMKVTVL
IETILAAFEMEEILWALRPHIVGLNAGRWDYLFSIIKKFRRQPDVMPADRQQITMTVPFM
RAYTELLVKTCHRRGAYAIGGMAAFIPSRRDPEINRVALAKVEDDKEREARDGFDGTWVA
HPDLVPVATAVFDRVLGPRPHQRDRQRDDVVVTADDLLDFRVPGGTMTEAGLKNNVAVAI
QYLAAWLGGSGAVGLYNLMEDAATAEIARAQVWQWITHGVRLSDGKPVTAQLVERLIQEG
LQEWGAHWPERDAAVDVFRSVALSSEWVDFLTLPAYDRLLAILH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggacatcaagggtccaacggttccgggaagcgaacgcattttaacatcggac
gcgctcacctttctggaggatttgcatcggacctttaacccgcggcggttggagcggtta
cgcgcccgtcaggaaatccaacaacgcatctttcagggatggcggccggactttcggccg
gatacccgagagatacgggaatccgaatggacggtgggaaccatacccgccgatctcacg
gatcgccgggtggaaatcaccggtccgacggatcgcaaaatggtgattaatgccctgaat
tccggggctcgggtctttatggccgacttcgaagacgcgaacagtccgacttggaccaac
ctggttttgggtcagatgaacttaatcgacgcgattgagcggacgattacgttcgaatcg
cctcagggggagacataccgcttaaaggatcaggtggccaccttggtggtgcgaccgcgg
ggatggcatttgcccgagcggcatctgacggtagacggtgaaccgatggcgggagccttg
gtcgatttcggactgtacgtgtttcacaacgcccgccgactggtggaacgagggagtgcc
ccctatttatatttgccgaaactcgaaaacatggaagaagcccagttgtgggaagacgtg
ctcggctgggcggaggagcgggtggggcttcccttcggcaccatgaaagtgacggtactg
attgaaaccattttagcggcttttgaaatggaagagattttgtgggccttgcgtccgcac
attgtgggattgaatgcgggccgctgggactatctgttcagcattattaagaaattccgt
cgccaaccggacgtcatgccggccgaccggcagcaaattaccatgaccgtgccgtttatg
cgggcatacaccgaacttttggtcaaaacctgtcatcggcggggggcttatgccattgga
ggcatggcggcatttatcccgagccgccgggatccggagattaaccgcgtggcgctggcg
aaagtcgaggacgacaaagagcgggaagcgcgtgacggattcgacgggacctgggtggcc
catcccgacctcgtgccggttgcgaccgccgtttttgaccgggtgctggggccgcgtcct
catcaacgcgaccgccaacgggacgatgtggtcgtaaccgccgacgatttactggatttc
cgggtacccggaggcaccatgaccgaggcgggactgaaaaataatgtggcggttgccatc
caatacttggcggcttggctcggcggttcgggggcggtggggctttataacctgatggag
gatgcggcgaccgcggaaattgcccgggcccaagtgtggcagtggattacccatggcgtg
cggttgtccgacggtaagccggtgacggcccaactggtggaacggttaattcaagaaggc
cttcaggaatggggagcccattggcccgaacgggatgcggcggtggacgttttccggtcg
gtcgccttgtcgtccgaatgggtcgattttctcacattgccggcctatgaccgcctgtta
gcgattttacattaa

DBGET integrated database retrieval system