KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0110Help
Entry
Sulac_0110        CDS       T01746                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sap01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sap00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sap00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
136712..138286
Genome map
AA seq 524 aa AA seqDB search
MAVDIKGPTVPGSERILTSDALTFLEDLHRTFNPRRLERLRARQEIQQRIFQGWRPDFRP
DTREIRESEWTVGTIPADLTDRRVEITGPTDRKMVINALNSGARVFMADFEDANSPTWTN
LVLGQMNLIDAIERTITFESPQGETYRLKDQVATLVVRPRGWHLPERHLTVDGEPMAGAL
VDFGLYVFHNARRLVERGSAPYLYLPKLENMEEAQLWEDVLGWAEERVGLPFGTMKVTVL
IETILAAFEMEEILWALRPHIVGLNAGRWDYLFSIIKKFRRQPDVMPADRQQITMTVPFM
RAYTELLVKTCHRRGAYAIGGMAAFIPSRRDPEINRVALAKVEDDKEREARDGFDGTWVA
HPDLVPVATAVFDRVLGPRPHQRDRQRDDVVVTADDLLDFRVPGGTMTEAGLKNNVAVAI
QYLAAWLGGSGAVGLYNLMEDAATAEIARAQVWQWITHGVRLSDGKPVTAQLVERLIQEG
LQEWGAHWPERDAAVDVFRSVALSSEWVDFLTLPAYDRLLAILH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggacatcaagggtccaacggttccgggaagcgaacgcattttaacatcggac
gcgctcacctttctggaggatttgcatcggacctttaacccgcggcggttggagcggtta
cgcgcccgtcaggaaatccaacaacgcatctttcagggatggcggccggactttcggccg
gatacccgagagatacgggaatccgaatggacggtgggaaccatacccgccgatctcacg
gatcgccgggtggaaatcaccggtccgacggatcgcaaaatggtgattaatgccctgaat
tccggggctcgggtctttatggccgacttcgaagacgcgaacagtccgacttggaccaac
ctggttttgggtcagatgaacttaatcgacgcgattgagcggacgattacgttcgaatcg
cctcagggggagacataccgcttaaaggatcaggtggccaccttggtggtgcgaccgcgg
ggatggcatttgcccgagcggcatctgacggtagacggtgaaccgatggcgggagccttg
gtcgatttcggactgtacgtgtttcacaacgcccgccgactggtggaacgagggagtgcc
ccctatttatatttgccgaaactcgaaaacatggaagaagcccagttgtgggaagacgtg
ctcggctgggcggaggagcgggtggggcttcccttcggcaccatgaaagtgacggtactg
attgaaaccattttagcggcttttgaaatggaagagattttgtgggccttgcgtccgcac
attgtgggattgaatgcgggccgctgggactatctgttcagcattattaagaaattccgt
cgccaaccggacgtcatgccggccgaccggcagcaaattaccatgaccgtgccgtttatg
cgggcatacaccgaacttttggtcaaaacctgtcatcggcggggggcttatgccattgga
ggcatggcggcatttatcccgagccgccgggatccggagattaaccgcgtggcgctggcg
aaagtcgaggacgacaaagagcgggaagcgcgtgacggattcgacgggacctgggtggcc
catcccgacctcgtgccggttgcgaccgccgtttttgaccgggtgctggggccgcgtcct
catcaacgcgaccgccaacgggacgatgtggtcgtaaccgccgacgatttactggatttc
cgggtacccggaggcaccatgaccgaggcgggactgaaaaataatgtggcggttgccatc
caatacttggcggcttggctcggcggttcgggggcggtggggctttataacctgatggag
gatgcggcgaccgcggaaattgcccgggcccaagtgtggcagtggattacccatggcgtg
cggttgtccgacggtaagccggtgacggcccaactggtggaacggttaattcaagaaggc
cttcaggaatggggagcccattggcccgaacgggatgcggcggtggacgttttccggtcg
gtcgccttgtcgtccgaatgggtcgattttctcacattgccggcctatgaccgcctgtta
gcgattttacattaa

DBGET integrated database retrieval system