KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0111Help
Entry
Sulac_0111        CDS       T01746                                 

Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulac_0111
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sulac_0111
Enzymes [BR:sap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Sulac_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
138305..139585
Genome map
AA seq 426 aa AA seqDB search
MTELNDRIRMIEEQWRTPRFEGITRGYGAADVAKLQGSVMIEHTLARRGAERLWRLLHER
HFVPALGALTGNQAVQQVKAGLEAIYLSGWQVAADANLAGQTYPDQSLYPANSVPEVVRR
INRALMRADQIDTLEGRHGTDWFAPIVADAEAGFGGPLNVFELTKALIEAGAAGVHLEDQ
MSSEKKCGHMGGKVLIPTSWAVRNLTAARLAMDVLGVPTILVARTDANGANLLTSDVDPA
DHPFMTGERTAEGFYRVKSGLDQAVHRGLAYAPYADMIWCETSEPDLDEAREFARRIHAE
FPGKLLAYNCSPSFNWRRRWDERGLERFQIELADMGYKFQFITLAGFHALNYSMFQLAHD
YKANGMKAYADLQDQEFQAEKDGYTAVRHQREVGAGYFDEVSLVISGGSSSTIALVGSTE
EAQFQS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacggagttgaacgatcgcatccggatgatcgaggagcaatggcgcacgccacggttt
gagggaattacccggggatacggcgcggccgacgtggcgaagttgcagggaagcgtcatg
attgagcacaccttggcgcgacgaggcgccgagcggctctggcggcttttgcatgaacgt
cattttgtccccgcgttgggcgctttgacgggtaatcaagcggtccagcaagtcaaggcg
gggttggaagccatctatttgagcggatggcaggtggctgccgacgccaacttggccggg
caaacgtatcccgatcagtcgttatacccggcgaacagcgtgcccgaagtcgtgcgtcgg
atcaatcgggcgctgatgcgggccgaccagattgacacgttggaaggtcggcacggtacc
gactggtttgcgcccattgtggccgatgcggaagccgggttcggcggtcccttaaacgtc
tttgaattgacgaaggcgctgattgaggcgggtgcggccggggtgcatctcgaagaccaa
atgtcatccgaaaagaaatgcgggcatatgggcgggaaagtgctgattcccacttcttgg
gcggtacgcaacttgacggcggcccgtttggccatggatgtgctgggcgtgccgaccatc
ttggtggcccgaaccgatgcgaacggggccaaccttctcacgtccgacgtcgatccggcc
gaccatccctttatgaccggggaacgcacggcggaaggcttttaccgggtcaagagcggg
ctggatcaggcggtgcaccgagggctggcctacgcgccctatgcggacatgatttggtgc
gaaacctcggaacccgatttagacgaagcgcgggaatttgcccgacggattcacgcggaa
ttccccggcaagcttttagcctacaactgctcgccgtcatttaactggcgccgtcgttgg
gatgagcgggggctggaacgcttccaaatcgaattggccgacatgggctataagttccag
ttcattacgctggccggattccacgcgttgaattacagcatgtttcagctggcccacgac
tataaggcaaacggcatgaaggcctatgccgatttgcaggatcaggaatttcaggccgaa
aaagacgggtacacggccgttcggcatcagcgggaagtgggggccgggtattttgacgag
gtgtcgctagtgatttccggcggttcgtcctcaaccattgcgttggtcggttcgaccgaa
gaagcgcaatttcaatcgtaa

DBGET integrated database retrieval system