KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0111Help
Entry
Sulac_0111        CDS       T01746                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sap01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sap00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
138305..139585
Genome map
AA seq 426 aa AA seqDB search
MTELNDRIRMIEEQWRTPRFEGITRGYGAADVAKLQGSVMIEHTLARRGAERLWRLLHER
HFVPALGALTGNQAVQQVKAGLEAIYLSGWQVAADANLAGQTYPDQSLYPANSVPEVVRR
INRALMRADQIDTLEGRHGTDWFAPIVADAEAGFGGPLNVFELTKALIEAGAAGVHLEDQ
MSSEKKCGHMGGKVLIPTSWAVRNLTAARLAMDVLGVPTILVARTDANGANLLTSDVDPA
DHPFMTGERTAEGFYRVKSGLDQAVHRGLAYAPYADMIWCETSEPDLDEAREFARRIHAE
FPGKLLAYNCSPSFNWRRRWDERGLERFQIELADMGYKFQFITLAGFHALNYSMFQLAHD
YKANGMKAYADLQDQEFQAEKDGYTAVRHQREVGAGYFDEVSLVISGGSSSTIALVGSTE
EAQFQS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacggagttgaacgatcgcatccggatgatcgaggagcaatggcgcacgccacggttt
gagggaattacccggggatacggcgcggccgacgtggcgaagttgcagggaagcgtcatg
attgagcacaccttggcgcgacgaggcgccgagcggctctggcggcttttgcatgaacgt
cattttgtccccgcgttgggcgctttgacgggtaatcaagcggtccagcaagtcaaggcg
gggttggaagccatctatttgagcggatggcaggtggctgccgacgccaacttggccggg
caaacgtatcccgatcagtcgttatacccggcgaacagcgtgcccgaagtcgtgcgtcgg
atcaatcgggcgctgatgcgggccgaccagattgacacgttggaaggtcggcacggtacc
gactggtttgcgcccattgtggccgatgcggaagccgggttcggcggtcccttaaacgtc
tttgaattgacgaaggcgctgattgaggcgggtgcggccggggtgcatctcgaagaccaa
atgtcatccgaaaagaaatgcgggcatatgggcgggaaagtgctgattcccacttcttgg
gcggtacgcaacttgacggcggcccgtttggccatggatgtgctgggcgtgccgaccatc
ttggtggcccgaaccgatgcgaacggggccaaccttctcacgtccgacgtcgatccggcc
gaccatccctttatgaccggggaacgcacggcggaaggcttttaccgggtcaagagcggg
ctggatcaggcggtgcaccgagggctggcctacgcgccctatgcggacatgatttggtgc
gaaacctcggaacccgatttagacgaagcgcgggaatttgcccgacggattcacgcggaa
ttccccggcaagcttttagcctacaactgctcgccgtcatttaactggcgccgtcgttgg
gatgagcgggggctggaacgcttccaaatcgaattggccgacatgggctataagttccag
ttcattacgctggccggattccacgcgttgaattacagcatgtttcagctggcccacgac
tataaggcaaacggcatgaaggcctatgccgatttgcaggatcaggaatttcaggccgaa
aaagacgggtacacggccgttcggcatcagcgggaagtgggggccgggtattttgacgag
gtgtcgctagtgatttccggcggttcgtcctcaaccattgcgttggtcggttcgaccgaa
gaagcgcaatttcaatcgtaa

DBGET integrated database retrieval system