KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0119Help
Entry
Sulac_0119        CDS       T01746                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sap00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sulac_0119
DNA repair and recombination proteins [BR:sap03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Sulac_0119
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sulac_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8 HHH_3 IMS_HHH Cdd1 PHF5 MutS_II DUF3701
Motif
Other DBs
NCBI-ProteinID: AEW03692
UniProt: G8TVQ3
Position
146334..146930
Genome map
AA seq 198 aa AA seqDB search
MLYPEPIQDLVQELAKLPGIGPKTAQRLAFFLLNMPKGEAEQLAQAIIQARQRIRYCSEC
FNFTDADPCFICKNPARDAGWIMVVEHPKDVVAMEKTREFKGRYHVLHGAISPMEGIGPD
ELKIRELVTRLERVNPKEIVLATSSSLEGEATALYLARLLKPMGFKVTRIARGLPMGGDL
DYTDEMTLTKALEGRQDI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgttatatccggaacccattcaagacttggtgcaagaattggccaaactacccggcata
gggcctaaaacggctcaacgattggctttttttctattaaacatgcccaaaggcgaagcc
gagcaattagcccaggcgattatccaggcgcgtcagcgcatccgctattgctcggaatgc
ttcaattttaccgatgccgatccgtgttttatttgtaaaaaccctgcgcgggacgccggc
tggattatggtggtcgagcacccgaaagatgtggtcgcgatggaaaaaacccgcgaattt
aaagggcgctatcatgtcttgcacggggcgatttcccccatggaagggatcggcccggac
gagttgaagattcgcgagctggtcacgcggttggagcgggtgaaccctaaagaaatcgtc
ttggcgaccagttccagtttggaaggggaagccacggcgctgtatttggcccgcttatta
aagccgatgggctttaaagtcacgcgtattgcgcgcggcttgcccatgggcggcgatttg
gattatacggatgaaatgaccttaaccaaagccctggaaggccgccaagacatctag

DBGET integrated database retrieval system