KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0119Help
Entry
Sulac_0119        CDS       T01746                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sap00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sulac_0119
DNA repair and recombination proteins [BR:sap03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sulac_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
146334..146930
Genome map
AA seq 198 aa AA seqDB search
MLYPEPIQDLVQELAKLPGIGPKTAQRLAFFLLNMPKGEAEQLAQAIIQARQRIRYCSEC
FNFTDADPCFICKNPARDAGWIMVVEHPKDVVAMEKTREFKGRYHVLHGAISPMEGIGPD
ELKIRELVTRLERVNPKEIVLATSSSLEGEATALYLARLLKPMGFKVTRIARGLPMGGDL
DYTDEMTLTKALEGRQDI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgttatatccggaacccattcaagacttggtgcaagaattggccaaactacccggcata
gggcctaaaacggctcaacgattggctttttttctattaaacatgcccaaaggcgaagcc
gagcaattagcccaggcgattatccaggcgcgtcagcgcatccgctattgctcggaatgc
ttcaattttaccgatgccgatccgtgttttatttgtaaaaaccctgcgcgggacgccggc
tggattatggtggtcgagcacccgaaagatgtggtcgcgatggaaaaaacccgcgaattt
aaagggcgctatcatgtcttgcacggggcgatttcccccatggaagggatcggcccggac
gagttgaagattcgcgagctggtcacgcggttggagcgggtgaaccctaaagaaatcgtc
ttggcgaccagttccagtttggaaggggaagccacggcgctgtatttggcccgcttatta
aagccgatgggctttaaagtcacgcgtattgcgcgcggcttgcccatgggcggcgatttg
gattatacggatgaaatgaccttaaccaaagccctggaaggccgccaagacatctag

DBGET integrated database retrieval system