KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0146Help
Entry
Sulac_0146        CDS       T01746                                 

Definition
(GenBank) Butyrate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00010  Glycolysis / Gluconeogenesis
sap00620  Pyruvate metabolism
sap00640  Propanoate metabolism
sap00680  Methane metabolism
sap01100  Metabolic pathways
sap01110  Biosynthesis of secondary metabolites
sap01120  Microbial metabolism in diverse environments
sap01130  Biosynthesis of antibiotics
sap01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulac_0146
   00620 Pyruvate metabolism
    Sulac_0146
   00640 Propanoate metabolism
    Sulac_0146
  Energy metabolism
   00680 Methane metabolism
    Sulac_0146
Enzymes [BR:sap01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sulac_0146
Lipid biosynthesis proteins [BR:sap01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sulac_0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C FeoA
Motif
Other DBs
NCBI-ProteinID: AEW03719
UniProt: G8TW76
Position
complement(172417..173988)
Genome map
AA seq 523 aa AA seqDB search
MSAEYWNFSTDVIHEWARQRKDRPALYIVEPDGRRRQISFGVLGSVINQTVHYFRDHGIR
PGDRVLVMLGKNPAFWPVMVALLQMGAVPMPATTQLTDRDIHFRLSRAESQAAILLPEIA
TRLSPDVKSLLNVRIAVGSVPDFDLYDPWHLTTPTHLWSHPTRVDDPALLYFTSGTTGHP
KMVLHTHDYPRAHHITASYWLGLTADDLHWNLSDTGWAKAAWSSLFGPWMVGATVLVDPL
VGRFRPEDLVSILSREPVTSLCAPPTAYRMLVQLDLKPGQFPALRSLAAAGEPLNPEIIA
AMERMTGLTVRDGYGQTETVLLIGNPPGAPVKPGSMGRPAPPFTMAVLDDDGQPVVGREG
DIALLVSPERPPGLFETYLGDPDEVAKRRRGPWYLTGDRAIQDDEGYFWFVGRADDVIIS
AGYRIGPFEVESALIEHPAVVEAAAVASPDPVRGAVVKAFVVLRPDVTPSDALVAELQEH
VKKTTAPYKYPRRIEFVHELPKTVSGKIRRVELREREWAAPPS
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagccgaatattggaattttagtaccgatgtcatacacgaatgggcccgccaacga
aaagaccgacccgccctttatatcgtcgagccggacggtcgccgtcggcagattagtttc
ggtgtactcggctccgtcatcaatcaaacggtgcattatttccgtgaccacggcattcga
cccggcgaccgggtcctcgtcatgctcggcaaaaatccggccttttggcccgtcatggtc
gccctgttacaaatgggcgccgtacccatgcccgccaccacccaactcaccgaccgcgat
atccactttcgcttgagccgggccgaatcccaggccgccattttgctgccggaaattgcc
acccgcctctcccctgacgtcaaaagcctcttaaacgtccgcatagcggtcggatcggtg
ccggattttgacctgtacgatccctggcatttgaccacgcccacccatttgtggagtcat
cccacccgcgtcgacgatccggctttgctgtatttcaccagcggcaccaccggccacccc
aaaatggttttgcatacccatgattaccctcgggcccaccacatcaccgccagctattgg
ctaggattgaccgcggacgacctccattggaatctgtccgataccggatgggcgaaagcc
gcctggtcttccctgtttggtccctggatggttggcgccacggttctggtggatccgttg
gtgggccggtttcggccggaagatctggtgtcgattctttcccgcgagccggtcaccagt
ctctgtgccccgcccacggcctatcgcatgctcgtccaactggatctcaagcccggtcaa
tttcctgccctccgatccctcgccgcggccggcgagcccttaaatcccgagatcatcgcc
gcgatggagcggatgaccggcctgaccgtgcgagacggctacggccaaaccgagaccgtc
ctcctcatcggcaacccaccgggagcaccggtcaaaccgggttctatggggcgtccggct
ccgcccttcacgatggctgttttagatgacgacggacaaccggtcgtcggccgtgaagga
gatatcgctctgctcgtatcgcccgaacgtccgccgggcctgtttgaaacatacctggga
gatcccgacgaagtcgccaaacgccggcggggaccgtggtatcttaccggagatcgggcg
atccaagatgacgaggggtacttttggtttgttgggcgcgccgacgacgtgattattagc
gccgggtatcggattggtcccttcgaagtggaatcggccttaattgaacatcccgccgtg
gttgaggcggccgccgtggccagtccggatcccgtacggggtgccgtggtcaaagcgttt
gtagttctacggccggacgtcacgccgtcggacgcgttagtcgccgaactacaagagcac
gtgaaaaaaaccaccgcaccctataaatatccgcggcggattgaattcgttcacgaattg
ccgaaaaccgtctccggtaaaatccggcgcgtcgagctccgtgaacgcgagtgggcagcg
ccccccagctaa

DBGET integrated database retrieval system