KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0164Help
Entry
Sulac_0164        CDS       T01746                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sap00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
189103..189966
Genome map
AA seq 287 aa AA seqDB search
MILWAQAKINLGLWVGPRQPTGYHLVDTVMYPIEVKDRIVLEPSHTLRCDSDTPGVPVGE
QNLMMRAYHWAREHWGPLPTVRMAVQKQIPLGAGLGGGSADAGAVLRWAWHELGFGPPPA
VEGTEAIGMDVPFFVSGRPARARHYGELLTPVADRLQGFWVVLANPGWPLATHVVYRAWD
EVGRESDNRISEVIEGIERGELAVDGLQNDLEKAAFRVDPRLQAFRQALERWLFPVPCFL
SGSGATYYMLGSDPADPEWAYWAQDRLRDRGVAWVMAARLGMGKDEE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgatattgtgggcgcaggccaaaattaatttaggcctctgggtggggccacgacagccg
acgggctatcatctcgtggatacggtgatgtatccgattgaggtgaaagaccggatcgtg
ttggagccgagccatacgcttcggtgtgacagcgatacgcccggagtacctgtcggcgag
caaaatctcatgatgcgggcatatcattgggcccgcgaacattggggacctttaccgacg
gtgcggatggcggtccaaaagcaaattccgctcggtgccggactagggggaggcagtgcg
gatgccggtgcggttttgcgctgggcctggcacgaactcggattcggtccacctccggcg
gtcgagggcacggaggccatcgggatggatgtgcccttttttgtttccggacgtccggcg
cgtgcgcgtcattatggcgagctcttgacgccggtggccgatcgactgcaagggttttgg
gtcgtcctggcgaatccgggttggcccttggccacgcatgtggtctaccgggcgtgggac
gaggtggggcgagagtccgacaatcgcatttctgaagtcattgagggcatagagcgcggc
gaactggcggtcgacgggttacaaaacgatttggaaaaggccgcctttcgggtggaccct
cggcttcaagcatttcggcaggctctcgaacgctggctttttccggtgccctgcttttta
tccggaagtggggcaacgtattatatgctaggatcggatccggccgatcccgaatgggcg
tattgggcacaggatcgtttacgcgatcggggggtggcttgggttatggccgcccgcttg
ggtatgggaaaggatgaggaatag

DBGET integrated database retrieval system