KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0194Help
Entry
Sulac_0194        CDS       T01746                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sulac_0194
   00052 Galactose metabolism
    Sulac_0194
   00500 Starch and sucrose metabolism
    Sulac_0194
   00520 Amino sugar and nucleotide sugar metabolism
    Sulac_0194
Enzymes [BR:sap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sulac_0194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
214236..215147
Genome map
AA seq 303 aa AA seqDB search
MITSSNRNSQAVHKAVIPAAGLGTRFLPATKAQPKEMLPIIDTPTIQLVVEEAVASGIDD
FLVVIGRDKGSIEDHFDRAPELEEFLRTRGKDDLLDIVQAVSRLANLHFIRQKVPMGLGH
AVLQARRHVGQDPFAVLLGDDVMVGQPPVLSQLIARWQPGVSVVAVERVSREEASRYGVV
FGQWDAQGVFRVNRLVEKPAPADVPPEPLAIMGRYVLEPDIFQALAEVTPGQGGEVQLTD
ALDLLARERQLIAVPYQGKRYDVGEKLGFVKATIEAALDRADLRDALIPYLKELLARVTM
PSL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatcacatcctctaatcggaatagtcaagcggtgcataaggctgtcataccggccgcc
ggtctcggcacccgatttttgccggctacgaaggcccagccgaaagaaatgttgcccatt
atcgataccccgacgattcaacttgtcgtggaagaggcggttgcctccgggattgacgac
tttttagtggtgattgggcgagataaagggtccatcgaggaccatttcgatcgggctcct
gaactggaggaatttttacgtacccggggtaaggacgatttgttggatattgtgcaagcc
gtgagccgattggccaatttgcattttattcggcaaaaagttccgatggggctcggtcat
gccgttttacaggcccggcggcacgtggggcaagacccctttgccgtgctgttgggggac
gacgtgatggtcggtcagccgcccgtgttgtctcaattaatcgcgcgttggcagccgggg
gtctcggtcgtcgccgtggaacgggtatcccgggaggaggcgagccgctatggcgtggtc
ttcgggcaatgggatgcccaaggggtctttcgggtaaaccggttggtggaaaagcccgcc
ccggcggacgtaccgccggagcccttggccattatgggacggtatgtgcttgagcccgac
atttttcaggcgttggcggaggtgaccccaggccagggcggtgaggtgcagttaaccgac
gccttggatttgctggcccgggaacgtcagttgattgcggtgccctatcagggtaaacgc
tatgacgtcggggaaaagttgggtttcgtcaaggcgaccatcgaagcggctttggatcgc
gccgatttgcgggacgctttgatcccctatttgaaagagctcttggcccgcgtgaccatg
ccctcgctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system