KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0339Help
Entry
Sulac_0339        CDS       T01746                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulac_0339
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sulac_0339
Enzymes [BR:sap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Sulac_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
357752..358651
Genome map
AA seq 299 aa AA seqDB search
MTTKHIRIIGVPIDYGADRRGVDMGPSAIRYAGLHEKLRQAGHQVLDSGNLKVPVPESRQ
MKHPKLKFLDEIVQVNQVLARVVAKSVHDGEFPVVLGGDHSIAMGTIAGLLRVRPRLGMI
WFDAHGDFNTEETTPSGNVHGMPVAVAAGLSQSALALPFRDHFLDPAKIVYVGVRTLDPD
EAEALRQSQATVFSMHEVDRYGMREVMARAMDIVTQGTDGVHLSFDIDALDPLFAPGSGT
PYSGGLTDREAHLALELLAEADILTSMEMVEVNPILDEHNRTGELAANLIASALGHRII
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacaactaaacatatacgcattatcggggttccgatcgactacggcgccgaccgtcgt
ggcgtggatatggggcctagcgccattcgctacgccggtttacacgaaaaattacggcag
gccggccatcaggtattggacagcggcaatttgaaagtaccggtgccggaaagtcgtcaa
atgaagcacccgaagttgaagtttctggatgaaattgtgcaggtcaatcaggtattggcg
cgggtcgtggccaagtctgtccatgatggggaatttcccgtggtactcgggggcgaccat
agtatcgcgatgggcaccattgccggcctcttacgggtgagaccgcggctcgggatgatt
tggtttgatgcccacggggacttcaataccgaagagacgaccccatccggtaatgtgcat
gggatgcccgtcgcggtagcggccgggctcagtcagagtgcgttggccttaccgtttcgc
gatcattttctggatccggccaaaattgtctacgtgggggtccgtaccttggatcccgat
gaagcggaggcccttcggcaaagtcaggcgaccgtgttttccatgcatgaagtcgaccgt
tatggtatgcgggaagtgatggcacgggcgatggatattgtcactcagggcaccgacggg
gtgcatttaagtttcgatattgatgcgctggacccgctatttgccccgggatcggggacg
ccctacagtggcggactcaccgatcgggaagcgcatttggcgttggaattgttggcggag
gccgatatcttgacctcgatggaaatggtcgaagtcaatcccattttggatgaacataat
cgaacgggggagttggccgccaaccttattgcgtcggccctcggccatcgcattatttaa

DBGET integrated database retrieval system