KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0339Help
Entry
Sulac_0339        CDS       T01746                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00220  Arginine biosynthesis
sap00330  Arginine and proline metabolism
sap01100  Metabolic pathways
sap01110  Biosynthesis of secondary metabolites
sap01130  Biosynthesis of antibiotics
sap01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Sulac_0339
   00330 Arginine and proline metabolism
    Sulac_0339
Enzymes [BR:sap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Sulac_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEW03908
UniProt: G8TXK9
Position
357752..358651
Genome map
AA seq 299 aa AA seqDB search
MTTKHIRIIGVPIDYGADRRGVDMGPSAIRYAGLHEKLRQAGHQVLDSGNLKVPVPESRQ
MKHPKLKFLDEIVQVNQVLARVVAKSVHDGEFPVVLGGDHSIAMGTIAGLLRVRPRLGMI
WFDAHGDFNTEETTPSGNVHGMPVAVAAGLSQSALALPFRDHFLDPAKIVYVGVRTLDPD
EAEALRQSQATVFSMHEVDRYGMREVMARAMDIVTQGTDGVHLSFDIDALDPLFAPGSGT
PYSGGLTDREAHLALELLAEADILTSMEMVEVNPILDEHNRTGELAANLIASALGHRII
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacaactaaacatatacgcattatcggggttccgatcgactacggcgccgaccgtcgt
ggcgtggatatggggcctagcgccattcgctacgccggtttacacgaaaaattacggcag
gccggccatcaggtattggacagcggcaatttgaaagtaccggtgccggaaagtcgtcaa
atgaagcacccgaagttgaagtttctggatgaaattgtgcaggtcaatcaggtattggcg
cgggtcgtggccaagtctgtccatgatggggaatttcccgtggtactcgggggcgaccat
agtatcgcgatgggcaccattgccggcctcttacgggtgagaccgcggctcgggatgatt
tggtttgatgcccacggggacttcaataccgaagagacgaccccatccggtaatgtgcat
gggatgcccgtcgcggtagcggccgggctcagtcagagtgcgttggccttaccgtttcgc
gatcattttctggatccggccaaaattgtctacgtgggggtccgtaccttggatcccgat
gaagcggaggcccttcggcaaagtcaggcgaccgtgttttccatgcatgaagtcgaccgt
tatggtatgcgggaagtgatggcacgggcgatggatattgtcactcagggcaccgacggg
gtgcatttaagtttcgatattgatgcgctggacccgctatttgccccgggatcggggacg
ccctacagtggcggactcaccgatcgggaagcgcatttggcgttggaattgttggcggag
gccgatatcttgacctcgatggaaatggtcgaagtcaatcccattttggatgaacataat
cgaacgggggagttggccgccaaccttattgcgtcggccctcggccatcgcattatttaa

DBGET integrated database retrieval system