KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0743Help
Entry
Sulac_0743        CDS       T01746                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00010  Glycolysis / Gluconeogenesis
sap00051  Fructose and mannose metabolism
sap00562  Inositol phosphate metabolism
sap00710  Carbon fixation in photosynthetic organisms
sap01100  Metabolic pathways
sap01110  Biosynthesis of secondary metabolites
sap01120  Microbial metabolism in diverse environments
sap01130  Biosynthesis of antibiotics
sap01200  Carbon metabolism
sap01230  Biosynthesis of amino acids
Module
sap_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sap_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulac_0743
   00051 Fructose and mannose metabolism
    Sulac_0743
   00562 Inositol phosphate metabolism
    Sulac_0743
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Sulac_0743
Enzymes [BR:sap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sulac_0743
Exosome [BR:sap04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sulac_0743
  Exosomal proteins of bladder cancer cells
   Sulac_0743
  Exosomal proteins of melanoma cells
   Sulac_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Cu2_monooxygen
Motif
Other DBs
NCBI-ProteinID: AEW04250
UniProt: G8U0M8
Position
746076..746861
Genome map
AA seq 261 aa AA seqDB search
MQKARRPLLAANWKMYKSVADSLNYAEELVRRADEWVDLPADLLICPTALALWAVGQKLA
SYPVRVGAQNLDLGTEGAMTGALSARLIRAAGAQYVILGHSERRQHFGETDRLVAEKTRQ
ALDEGLMPIVCVGENDQENQQGLTTRVIQRQLAPVLEKLSPVDAASFVVAYEPIWAIGTG
KVPTYEDAQRVAQDIRQGILRQWGEEAASAVRVLYGGSVSPDNIGGFAAQPDIDGALIGG
ASLKVDNMVRMVQQWQEADKA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaggcacggcgcccattattggccgctaactggaaaatgtataaatcggtcgcg
gactctcttaactatgccgaggaattggtgcggcgtgccgatgaatgggtcgatttgccg
gcggatcttctcatttgcccgaccgccttggcgctatgggctgtggggcagaaactggcg
tcctatccggtgcgggtgggagcccagaatcttgacctaggaaccgaaggggcgatgacg
ggggctttgtcggctcggttaatccgagccgccggcgcccagtatgtcatattaggccat
tcggaacggcgtcagcactttggggaaaccgatcgcctagtggcggaaaaaacgcgtcag
gccctcgatgaagggttgatgccgattgtctgtgtcggagaaaacgatcaagaaaatcag
cagggattgacgacccgcgtgattcagcggcaattggctccggttttggaaaaattgagc
ccggtcgacgccgcgtcgttcgtggtggcctatgagcccatttgggccattggtaccggt
aaagtgccgacgtacgaggatgcccagcgggtggcccaggacattcggcaggggattctc
cgccagtggggtgaagaggcggcttcggcggtacgggtgctctacggagggtcggtttca
ccggataacattggcggattcgcggcccaaccggatatcgacggcgctttaatcggcgga
gcatcgttaaaagtggacaacatggtgcggatggtacaacaatggcaggaggcggacaag
gcatga

DBGET integrated database retrieval system