KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0743Help
Entry
Sulac_0743        CDS       T01746                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulac_0743
   01230 Biosynthesis of amino acids
    Sulac_0743
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulac_0743
   00051 Fructose and mannose metabolism
    Sulac_0743
   00562 Inositol phosphate metabolism
    Sulac_0743
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Sulac_0743
Enzymes [BR:sap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sulac_0743
Exosome [BR:sap04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sulac_0743
  Exosomal proteins of bladder cancer cells
   Sulac_0743
  Exosomal proteins of melanoma cells
   Sulac_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
746076..746861
Genome map
AA seq 261 aa AA seqDB search
MQKARRPLLAANWKMYKSVADSLNYAEELVRRADEWVDLPADLLICPTALALWAVGQKLA
SYPVRVGAQNLDLGTEGAMTGALSARLIRAAGAQYVILGHSERRQHFGETDRLVAEKTRQ
ALDEGLMPIVCVGENDQENQQGLTTRVIQRQLAPVLEKLSPVDAASFVVAYEPIWAIGTG
KVPTYEDAQRVAQDIRQGILRQWGEEAASAVRVLYGGSVSPDNIGGFAAQPDIDGALIGG
ASLKVDNMVRMVQQWQEADKA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaggcacggcgcccattattggccgctaactggaaaatgtataaatcggtcgcg
gactctcttaactatgccgaggaattggtgcggcgtgccgatgaatgggtcgatttgccg
gcggatcttctcatttgcccgaccgccttggcgctatgggctgtggggcagaaactggcg
tcctatccggtgcgggtgggagcccagaatcttgacctaggaaccgaaggggcgatgacg
ggggctttgtcggctcggttaatccgagccgccggcgcccagtatgtcatattaggccat
tcggaacggcgtcagcactttggggaaaccgatcgcctagtggcggaaaaaacgcgtcag
gccctcgatgaagggttgatgccgattgtctgtgtcggagaaaacgatcaagaaaatcag
cagggattgacgacccgcgtgattcagcggcaattggctccggttttggaaaaattgagc
ccggtcgacgccgcgtcgttcgtggtggcctatgagcccatttgggccattggtaccggt
aaagtgccgacgtacgaggatgcccagcgggtggcccaggacattcggcaggggattctc
cgccagtggggtgaagaggcggcttcggcggtacgggtgctctacggagggtcggtttca
ccggataacattggcggattcgcggcccaaccggatatcgacggcgctttaatcggcgga
gcatcgttaaaagtggacaacatggtgcggatggtacaacaatggcaggaggcggacaag
gcatga

DBGET integrated database retrieval system