KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0843Help
Entry
Sulac_0843        CDS       T01746                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sulac_0843
Enzymes [BR:sap01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Sulac_0843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
840752..841822
Genome map
AA seq 356 aa AA seqDB search
MKQVAIVGGGISGLSVAYALEALLVPELSDIVLFEASSELGGVIQSDMWQGQVLEGGPDT
LTDRPFGVLDLVHAIGLAHRLIGVRPGAQGTLVYGSDGWLKFSGQEARAYTLAGGLAELP
HAVASHLMRTRILRQARVQKLSWDTRGRVRVWWERGVLTADAVILAVPAPIAADLMRPLD
PDRARRLEQILYQPRAVVTAVYPSHAFVDVRVYTHTGFMTIKGAPLACSGASWMTTKWNY
PGARDHVVLRTFWGPPGVDPSPWSDRELIDRHEHDLTRALGPHQPPEFVRVFRHPYAVPQ
VPSGWTDSQPRVPYSSYIGMVGPFFAGAGLSDCVHRAWQEASRVTEWMTASGTGIG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggtggccattgtgggcgggggcatctctggactgagtgtggcgtacgctcta
gaggcgctattagtgccggaattgtccgatattgttttgttcgaggcgtcgtccgaactg
ggcggcgtcattcaaagcgacatgtggcaaggtcaggtgctggagggcggacccgatacc
ttaacggatcggccttttggcgtgctcgacttagtgcatgcgatcggattggctcatcgc
ttaattggggtgcgtcccggtgcgcaaggcacattggtctatggctccgacggctggctg
aaattttccggacaagaagcccgggcgtatacgttggccgggggattggcggaattgccg
cacgcggtcgcatcgcatctaatgcggacccgtattttacggcaagcgcgggtgcaaaag
ttgtcttgggacacccggggacgcgttcgggtatggtgggagcgcggtgttttaaccgcc
gatgccgtcattttggccgtgccggcgccgattgcggccgatttgatgcggccgttagac
ccggaccgggcccgacgtctcgaacaaattctctatcagccgcgggcggtggtcaccgct
gtatatccttctcatgcattcgtcgatgtacgggtatacacccataccggctttatgacc
attaaaggggcgccgttggcctgctccggggcgtcttggatgacaaccaaatggaactat
cctggggcccgtgaccatgtggtattacggacgttctggggaccaccgggggtagatccc
tcgccctggtctgatcgcgaattgatcgaccggcatgaacacgatttaacccgggcgtta
ggcccccatcaaccgcccgaatttgtgcgggttttccgccatccctatgccgtaccgcag
gtaccgagcggctggacggacagtcagccgcgggttccctattcgagttatatcggcatg
gtagggccttttttcgccggagcgggtttgtcggattgtgtccaccgggcctggcaagag
gcaagccgggtgacggagtggatgacggcgtcgggaacggggattggatag

DBGET integrated database retrieval system