KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0849Help
Entry
Sulac_0849        CDS       T01746                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Sulac_0849
Enzymes [BR:sap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Sulac_0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(846053..846724)
Genome map
AA seq 223 aa AA seqDB search
MAYLSENEARQAIVLAAHQLGESGMLFRGNHANLSARIDGDRFIMTRGGSIAHLTADDLA
ILDLSGRILSGQMDPTMQEIIQMHAGVYRTRSSVGAVIHTHAPHITAFAVAHEPIPLVYE
PLLRFGVSEAVPVVPWAPRGSEKSVSGILDIVAHHPGLPALMMANHGALVFHETPQSAAQ
LLATLDEAAELVILARALGGAKPLHPDAIHEVRERMQAFGSRR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcctatcttagcgaaaacgaagcccgacaagccatcgtcctcgcggctcatcaactc
ggcgagtccgggatgctgtttcgcggcaatcatgccaacttatcggcccggattgacggc
gatcgctttattatgacgcgtgggggatcgattgcccatttaacggcggatgacttggcg
atcttagacctgtccggtcgcatcttgtcgggacaaatggaccccacgatgcaggaaatc
attcaaatgcatgcgggagtctaccggacccgaagcagcgtgggcgccgtcattcatacc
catgctccgcatattaccgcctttgctgtcgcgcatgagcccattccgttggtctacgag
ccgcttttgcgctttggcgtcagtgaggcggtaccggtggtgccctgggcacctcgagga
tcggaaaaatcggtttccggcattctcgacattgtcgctcaccatccggggttaccggcg
ctcatgatggctaatcacggcgccttggtctttcatgaaacgcctcagtcggccgctcag
cttttagcgacgctggatgaagcggccgaattggtcattctcgcccgcgctcttggcggg
gccaagccgctgcatccggacgcgatccacgaagtccgcgaacggatgcaagcatttgga
agccgacgataa

DBGET integrated database retrieval system