KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0857Help
Entry
Sulac_0857        CDS       T01746                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulac_0857
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sulac_0857
Enzymes [BR:sap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Sulac_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
854430..855206
Genome map
AA seq 258 aa AA seqDB search
MRWVVKIGTSSLCEADGQLSWNKVLMFTRQIKALHERGHQVVVVTSGAIGTGMGTTKIRP
KTLSERQALAAIGQAHLMEYYRKALAPITMGQLLLTYPDISDPIRRDIFCQTLEHMLQWR
TIPVVNENDAVTDDESRIGDNDTLAAHLAVMVRANRLVILTDIDGLYTDNPYQNPGAQRI
DALPWVTLEHVEQFGAGEPGQFGAGGMATKLQAARIAQEAGIEMVLASSREPGVLQKIDA
PNWQGGTRFLARRGVSHA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgcgctgggtcgttaaaatcggcacctcaagcttatgtgaggcggatggccagttaagc
tggaacaaagtcctcatgtttacccgtcagatcaaggcgctgcatgagcgggggcaccaa
gtggtggtcgtgacctcaggcgcgattgggacggggatggggaccaccaaaatccgtcct
aagacgctgtctgagcgccaagccctggcggccattggacaggcgcacctcatggaatat
taccgtaaagcgttggctcccattacgatggggcagctgcttttgacctatcccgatatt
agcgatccgattcggcgtgacatattttgccaaacattggaacacatgttgcagtggcgg
accatcccggtcgtcaacgaaaatgatgcggtgaccgacgacgagtcgcgcattggcgac
aatgatacgttggcggctcatctagccgtgatggtccgggccaatcgtttggttatcttg
acggatattgacggactttataccgataacccttatcaaaatccgggtgcgcaacgcatc
gacgccttaccttgggttaccctagagcacgtggaacagttcggggccggcgaaccggga
caatttggggccggcggcatggccacgaagctgcaggccgcccgtatcgcgcaggaagcc
gggatcgagatggttctcgcgtcaagccgcgagcccggggttttgcaaaagattgatgcc
ccgaattggcaagggggcacgcggtttttggcacggaggggggtctcccatgcttaa

DBGET integrated database retrieval system