KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0894Help
Entry
Sulac_0894        CDS       T01746                                 

Definition
Acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulac_0894
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulac_0894
   00620 Pyruvate metabolism
    Sulac_0894
   00640 Propanoate metabolism
    Sulac_0894
  Energy metabolism
   00680 Methane metabolism
    Sulac_0894
Enzymes [BR:sap01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sulac_0894
Lipid biosynthesis proteins [BR:sap01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sulac_0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
892680..894242
Genome map
AA seq 520 aa AA seqDB search
MMDERWLQDIHRLKTRYQTDPVNAAWYLVGNKDPHKPALYYHRPDQSAVTFTYDELRRES
AKWAARLAAQGVRSKDRVAGLLPKRPELAAMILGAWRLGAVYVPLFTAFGSDAVRYRIEQ
SRAKVVVTDDTHREKVAGMRDVVVFNVDHPDQDPESLDVWQALSENDLLVLLFTSGTTGH
PKGVPVPIRALPAFEAYMRWGLDVRPSDRFWNLADPGWAYGLYYGLIGPWLVDQAIFWYG
GSFDPDRVMALIKEAGITNFAAAPTAYRAMRAQGAVLPDTLRAISSAGEPLNPEVIRWAE
TALGLPILDHYGQTELGMVINNHQVPELQRPLKWGSMGHPMPGFRAVVLDDDGHEVPPKT
EGHIALDIGQSPLFWFPGYEGSDSATQSRLTADGRYYLTGDDGSVDEEGYFFFTGRSDDV
ILSAGYRIGPFEVESTLMAHPAVAECAVVGVPDALRGEAIRAYVVLRPGFVTNAQLEDEL
KDWVRQRLAKTHYPREIRLVDTLPKTPSGKIQRFILRQSE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgaaagatggcttcaagacattcatcggttaaaaacccggtatcaaacggat
ccggtgaatgcggcctggtatttggtcggaaacaaagatccgcacaagccggcgctctac
taccatcggccggatcagtcggcggtgacctttacgtatgacgagctgaggcgggagtcg
gcgaaatgggcggcacggttggccgcgcagggggtccgttcgaaagaccgcgtcgccggt
cttttgccgaaacggccggagttggccgccatgatattaggcgcctggcgcttgggtgcg
gtctatgttccgctttttaccgccttcggttcggacgcggtccggtatcgcatcgagcaa
agccgggcgaaagtcgtcgtaacggacgatacccatcgggaaaaagtggcggggatgcgg
gacgtggtcgtattcaatgtcgatcacccggatcaagatcccgaaagccttgacgtatgg
caggccctctcggagaacgatctcttggtcttgctctttacctcggggaccacggggcat
cccaagggggtaccggtgcccatacgagccctgccggcatttgaagcgtatatgcggtgg
ggattggatgtgcggccgagtgaccggttttggaatctggcggatcccggctgggcctat
ggcctctattatggcttgattgggccctggctggttgaccaggcgatcttttggtacggc
ggatcgtttgacccggaccgggttatggctctcataaaggaggcggggattaccaatttt
gccgcggcgccgaccgcctatcgggccatgcgggctcaaggggcggtgcttcccgacact
ttgcgggcgatttccagtgccggtgaaccgttaaatccggaagtcatccgctgggccgaa
accgccctcggccttccgattttggatcattacggacaaaccgagctgggtatggtgatt
aataaccaccaagttccagagcttcaacgccctctcaaatgggggtccatggggcacccc
atgcccgggtttcgcgcggtggtccttgacgacgacgggcatgaagtgccgccgaaaacc
gaagggcatatcgcgctcgatatcgggcaatcgcccttgttttggtttcccgggtatgaa
gggtccgattcggcgacccagtcccgtttgaccgcggatggccgctattatctcaccgga
gatgacgggagtgttgacgaagaaggctatttctttttcaccgggcgttccgacgatgtg
attttaagcgcagggtatcggattggcccttttgaggtggaaagcaccttaatggcgcat
ccggccgtcgccgaatgcgcggtggtgggggtgcccgatgcattacggggggaggccatt
cgcgcctacgtggtactgaggccgggtttcgtgacgaatgcacaattggaagacgaatta
aaagattgggttcgtcaacggctcgccaagactcattatccccgtgaaattcggctggtg
gataccttgcctaaaacccccagcgggaaaattcaacgatttatcttgcgtcaaagcgaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system