KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0901Help
Entry
Sulac_0901        CDS       T01746                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sulac_0901
Enzymes [BR:sap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Sulac_0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
903126..904064
Genome map
AA seq 312 aa AA seqDB search
MKIEYPGIVPEEQMPRFSGRPSFMKLPWWGKDMDVSVAVIGVPFDGGTTFQSGARMGPWA
IRQASWGLYPYSRVHRISLADARLADAGDLRVVPMSVPDTLMLVEHQLGAFPGGTRFLAL
GGDHSVTLGLLRDVVRRRGPVGLIHFDAHSDLWDELWGQRYNHATVFRRAWEEGLILPDR
TIQVGIRGSLDHPDEDGEADRLGILQVSTDTWLSQGTRTTIHQIRNRVGRGPVYLSVDLD
VVDPAYAPGTGTPEAGGPSSHMLLSVLRGLAGLSFVGADVVELAPPLDPTIASGLVAATV
AQEALFLLTLAP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatcgagtacccggggatcgttccggaggagcagatgccgcggtttagcggccgc
ccgtcgtttatgaaattgccgtggtggggcaaggacatggatgtatcggtggccgtaatc
ggggtgccgtttgacggaggcacgacctttcaatccggggcgcgtatggggccttgggca
atccgccaagcgtcttggggcctctatccttatagtcgtgtgcaccggattagcctggcg
gatgcccgcttggccgatgccggagatttgcgggtggttcccatgtcggtaccggatacg
ctgatgctcgtcgagcaccaactcggggcgtttcccggcggcacccgctttctggccttg
ggtggcgaccattccgtcaccctcgggcttttgcgggatgtggtccggcgacgggggccg
gtcggtctgatccattttgatgcccacagtgatttgtgggatgagttatggggtcagcgg
tataaccatgcgacggtatttcggcgcgcctgggaagaggggctcattcttcccgatcgg
acaattcaagtcggcattcgtggaagtcttgaccacccggatgaagacggggaagccgac
cggctagggattttacaagtgagtacggacacgtggctttcgcaagggacccgcacgacc
atccatcagattaggaatcgggtaggccggggaccggtttacctgtcggtcgacctggat
gtggttgatccggcgtacgcgcccggcaccggaacgccggaggcgggcggcccctcaagt
cacatgctcttgtcggtattacggggactggcggggttgtctttcgtgggcgcggatgtg
gtggaactggcgcccccgctcgatcccacgatcgcatccggcttggtggcggcgacggtt
gctcaagaagcgttgtttttgttgacgttggcaccataa

DBGET integrated database retrieval system