KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0935Help
Entry
Sulac_0935        CDS       T01746                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sap00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
941015..942514
Genome map
AA seq 499 aa AA seqDB search
MSGRYILALDQGTTSSRAILFNQQALPVAIGQREFRQIYPEPGWVEHDPEEIWASQWEAI
EECLQKAEATPDDILAIGITNQRETTILWDHATGRPVYNAIVWQCRRTADFAASLRDRGL
SPMVQEKTGLVIDAYFSGTKVAWLLDHVPGLRERAEAGEIKFGTVDSWLIYKLTGGARHV
TDYSNASRTLMFNIHDLAWDLELLSLLNIPAAVCPEVVDSSGIVGYTDPRWFGRPIPIAG
IAGDQQAALFGQGCYDPGMAKNTYGTGSFMLMNTGTEPVTSRHGLVTTIAWSINGTVSYA
LEGSIFVTGAVVQWLRDELGVIQDAAETEALAASVPDTGDVYFVPAFVGLGAPIWDSYAR
GLIIGLTRGTKKAHLVRAALESMAYQTRDVLEVMVKDSGFPVTTLRVDGGAIRNQFLAQF
QADIVGCRVDRPRVTETTALGAAFLAGLAVGFWPDLSTIQQTWQKDASFEPQMDPATREA
RYQRWQAAVDRARGWVGHE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtcgatatattttggccttagatcagggaaccacgagttctcgtgccatttta
ttcaatcagcaggcgttgccggtggccattgggcaacgggagtttcgtcaaatctatccg
gaacccggctgggtggaacatgatccggaagaaatttgggcgtcgcaatgggaagccatt
gaagagtgtctccaaaaggcagaagcaacgccggacgacattttggccatcgggattacc
aaccagcgtgagacgacgattctctgggatcacgccaccggccggccggtatacaacgcc
attgtttggcaatgtcggcgcacggcggatttcgctgcatccttacgggaccgcggttta
agccccatggttcaagagaaaaccgggcttgtaatcgacgcgtacttttccggcaccaaa
gtggcttggctattggatcatgtgccgggcctgcgggagcgggccgaggccggtgagatt
aaattcgggacggttgacagttggcttatctacaaattgacggggggagcacggcacgtc
accgattattccaatgcctcgcggacactgatgtttaacattcacgacttggcctgggac
ctggaactcctgtcattattgaatattccggccgccgtgtgccccgaggtggtggattcc
tccggtattgtcgggtacaccgatccccggtggtttggacggccgattccgattgctggc
attgccggggatcagcaggccgcgttattcgggcaagggtgttatgacccgggaatggcc
aagaacacgtacgggaccggatcgttcatgctgatgaacacaggcaccgagccggtgacg
tcccggcatgggctggtgacgaccattgcctggagcattaacggaacggtctcctatgcc
ttggagggctcgatctttgtcaccggagccgtggtccaatggctgcgggacgaattgggg
gtgattcaagacgcggcggaaaccgaggctttggccgcatccgtgcccgacaccggcgat
gtctactttgttccggcttttgtcggattgggcgcacccatctgggacagttatgctcga
gggttgattatcggcctgacccgcgggacaaaaaaagcgcatctggttcgggcggcactg
gagtcgatggcgtaccagacgcgtgacgtgctcgaagtcatggtcaaggacagcggattt
ccggtgacgaccctgcgggtggacggaggagccatccggaatcaattcttggcccagttt
caagccgatattgtcgggtgccgggttgatcggccgcgggttacggaaacgacggcctta
ggggcggcgtttttggccgggttagccgtcgggttttggccggatctatcgactatccaa
caaacgtggcaaaaagacgccagctttgagccccaaatggatcccgccacacgggaagcg
cgctaccaacgatggcaagccgcggtcgaccgcgcgcgcgggtgggtcggccacgaataa

DBGET integrated database retrieval system