KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0940Help
Entry
Sulac_0940        CDS       T01746                                 

Definition
Formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sap01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:sap00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sap00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(945784..946917)
Genome map
AA seq 377 aa AA seqDB search
MKAVVYQGPFQVAVQEVPEPTIQHPADVIVKITTSCICGSDLHMYEGRTAAEPGIIFGHE
NMGVVVETGSAVSRLKVGDRVVMPFNIGCGHCQNCESGYTAFCTEVNPGFAGGAYGYVAM
GPYPGGQAQYLRVPWADFNALSLPPGREHESDFALLADIFPTGWHGVSLSGFQPGESLVV
FGGGPVGLMAAYSAVLRGASEVYVVDRVPERLEKARQIGTIPINFDQADAVDQILDQRHG
AYVDRAVDAVGYQATQAGREVPNTVLVSMVRVVRATGGLGVPGLYVPSDPGGVDPLAREG
YLSFPVGKFFEKGLKMGTGQCNVKQYNRYLRDLIIAGRATPSFVVSHEISLEDAPLAYEK
FDKRIEGYTKVLIHPND
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggttgtctaccaagggccgtttcaagtagccgtccaagaggttcctgaaccc
acgattcagcatccggcagatgtgatcgtcaaaatcaccacctcctgtatttgcgggtcg
gatttgcacatgtacgaggggcgtacggccgccgagccgggcatcatttttggtcacgaa
aatatgggcgtggtggtcgaaaccggatccgcggtaagtcggttaaaagtcggcgatcgg
gtcgtcatgcccttcaatatcggctgcggccattgccaaaattgtgaatccggttatacg
gccttttgcactgaggtgaatcccggttttgccgggggcgcctacggttatgtcgccatg
ggcccctatcccggcgggcaagcccaatatctacgggtgccctgggctgattttaatgcg
ctcagtctgccccccggccgcgaacacgaatcggacttcgcgttgttggccgatattttc
cccaccgggtggcacggtgtcagtttgtccggattccaacccggcgaatccctggttgtt
ttcggcggcgggccggtcggcttaatggcagcgtatagcgccgtgctccggggcgcctcc
gaagtgtatgttgtcgaccgcgttcccgaacggctggaaaaagctcgtcaaatcggtacg
atcccgattaactttgatcaagcggatgccgtcgaccagattttagatcagaggcatggc
gcctacgtggatcgagcggttgacgccgtaggatatcaggccacgcaagccggccgcgaa
gtgcctaacacggttctcgtctccatggttcgtgtagtacgggcgaccggagggctcggg
gtgcccggcctttatgtgccctcggaccctggaggtgtggacccgttggcacgggaagga
tatctttcgtttcctgtcggcaagtttttcgaaaaaggtctcaagatgggcaccggacaa
tgcaatgtcaagcaatataaccgttatttacgggacttaatcatcgccgggcgagccacc
ccaagcttcgtcgtctctcatgaaatttccctcgaggatgcccctctggcctatgaaaag
tttgataaacggattgaggggtacaccaaagtcttgattcatccgaacgattaa

DBGET integrated database retrieval system