KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_0948Help
Entry
Sulac_0948        CDS       T01746                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulac_0948
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sulac_0948
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sulac_0948
Enzymes [BR:sap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sulac_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(956066..957115)
Genome map
AA seq 349 aa AA seqDB search
MSGVIQRYRKYLDLPDLEPVSLGEGSTPLIPWSQWHNTRVWLKLEGMNPTGSFKDRGMTV
AVSIARHEGAKAVICASTGNTAASAAAYAGRAGLSALVVVPQGQVTREKMLQASAYGATL
LAVEGNFDAALALVRRTADENPAIALVNSVNPWRLRGQETGAYEVVDSLGHAPAALVIPV
GNAGNISAYFQGFRRYGRGIPQMMGIQAEGASPLVKGEFFEHPQTVASAIRIGKPASAHL
AREAVAESRGRFFAVSDALILAAQKELARGGVYVEPASATAYAGLKQLFEMGAIPAGDVV
AVLTGSGLKDGTTPLQWVDAEPVVTTADTILSTINQLLSKKEQDAHVAH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcgtgatccaacgctaccgcaaatatctcgatttaccggatctggaacccgtg
tccttaggtgaaggctctacgcccttaattccctggagccagtggcataacacccgggtc
tggcttaagttggaagggatgaatcccaccggatcgttcaaagaccgaggtatgacggtg
gccgtcagtattgcacgccatgaaggcgccaaagccgtcatttgtgcctccaccggtaat
acggcggcatccgccgccgcttatgccggacgggcgggattatccgcgttggtggtcgta
ccccaaggccaagtcacccgagaaaaaatgttgcaagccagtgcctatggtgccacgttg
ttggctgtcgaaggtaatttcgatgccgcgctggccctcgtccgacggaccgcggacgaa
aacccggcgattgccttggtcaattccgtcaacccctggcggcttcgggggcaagaaacg
ggagcctacgaagtcgtcgacagcttgggtcatgcgccggccgcgttagtgattccggtc
ggcaatgccggtaacatttcggcttactttcaagggtttcgccgctacgggcggggaatt
ccgcagatgatgggcattcaggccgaaggggctagcccgctggtaaaaggcgaatttttc
gaacacccgcaaacggtcgcgtcggccatccggattggtaaaccggccagtgcccatctg
gcccgagaagccgtggccgagtcccgagggcgatttttcgccgtcagcgatgccctcatt
ctggccgcccaaaaggaattggcccgcggcggagtgtacgttgagccggcctccgcgacc
gcgtacgccgggttaaagcagttattcgagatgggagcgatcccggcgggggacgtggtg
gccgttttaaccgggtcgggcctcaaagacggtaccacccctcttcagtgggtcgatgcc
gaaccggtggtcaccactgccgatacgattttatccacgattaatcagctgttgtccaaa
aaggagcaggacgcccatgtggcacattaa

DBGET integrated database retrieval system