KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_1341Help
Entry
Sulac_1341        CDS       T01746                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sulac_1341
Enzymes [BR:sap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Sulac_1341
Exosome [BR:sap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sulac_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1318068..1319045
Genome map
AA seq 325 aa AA seqDB search
MFPSFPIERPRRLRRTEVLRDLVRETRLHPAELIYPVFVKPGRDRQDPIQSMPGIFQWSP
DTLERHLTTAYQKGIKSFLLFGIPEHKDARGSEAYDPQGIIQVTLRRLRDALSDAVLIAD
LCLCEYTDHGHCGVLKGETVDNDVTLDLLAETAVRQAEAGASIVAPSDMMDGRVGAIRRA
LDQQGFQDIPIMSYAAKYASAFYGPFREAAENTPAFGDRRSYQMDPANRREALKEVFLDI
EEGADLVIVKPALPYLDIVSDVKAAVKVPVAAYQVSGEYAMIEAAGRNGWIDRRRVVMET
LTAIRRAGADMIITYFAPEVVDWIE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttccttcgtttcctatcgaaaggccgcgtcgattgcggcgcaccgaggttttgcgg
gatttagtgcgggaaacccgcctgcatccggcggaattgatttacccggtgttcgtcaaa
cccgggcgcgaccggcaagaccctatacagtccatgccggggatttttcagtggtcaccg
gataccttggaacgccatctgacgacagcctatcaaaaagggattaaaagctttttattg
tttggcataccggaacataaagatgcgcggggatccgaggcgtatgatccccaggggatt
attcaagtcacgcttcgtcgtttgcgtgacgcgctttcggatgcggtactgatagccgac
ttatgcttgtgtgaatataccgaccatgggcactgtggggtgcttaaaggggagaccgtg
gataatgacgtgaccttggatttgctggcggaaacggcggttcggcaggcggaagccggg
gcgagtatcgtcgcaccgtcggatatgatggacggacgcgtgggcgccattcggcgggct
ctcgaccaacagggttttcaagacatcccgattatgtcctacgcggccaagtacgcctcc
gccttttacgggccatttcgggaagcggcggaaaacacgccggcgtttggcgatcgccga
tcgtatcaaatggacccggcaaatcgccgggaggcgctcaaagaggtgtttttggatatc
gaagaaggggcggacctggtcattgtgaagccggcccttccgtatctggatattgtgtcg
gatgtcaaagcggcggtaaaagtgccggtggccgcctaccaagtttccggcgaatatgcc
atgattgaagcagccggtcgaaacggctggattgaccgacgccgggtggtgatggaaacc
ttaacggccattcggcgggccggagcggatatgattatcacctatttcgccccggaagtt
gtggattggatcgaataa

DBGET integrated database retrieval system