KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_1406Help
Entry
Sulac_1406        CDS       T01746                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sap00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sulac_1406
Enzymes [BR:sap01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Sulac_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1383998..1384606
Genome map
AA seq 202 aa AA seqDB search
MIVQVAGTLTAAQPGYVIVMAHGLGLGLDIPRETYERLPGVGSPVQLFTHLIVREDQWRL
IGFATERERAVFLDLIDISGVGVKAALSVMSQLGIQGLAEAVRQGQWKLIQKAPGIGAKM
AQRIQLELGTKWGGTTEVLAEPALPPDAGPVDDEVLEALRLLGYQDGEARRALGQVTAEE
ATERLRQALRWLGGGPQSPPRS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgattgttcaggtcgcgggtacgttaacggcggctcaacccggctatgttatcgtcatg
gcccacgggctcggtctcgggctggatattccgcgggagacgtatgaacggctcccgggg
gtggggtcacccgtccagttgtttacgcatttaattgtccgcgaggatcaatggcggttg
attgggtttgcgacggagcgggaacgggcggtgttcctagacctgattgacattagcgga
gtcggcgtcaaggcggccttaagcgtcatgagtcaattagggatccaaggattggcggaa
gccgtgcggcaaggtcaatggaagctgattcaaaaggctcccgggataggggcaaagatg
gcgcaaaggattcagctggaactgggcacgaaatggggcgggacgaccgaggttctggcc
gaaccggcgctaccgccggacgccggcccggtggacgatgaggtgctggaagcgttacgc
ctgttgggttaccaagacggcgaggcccgtcgggccttaggtcaggtaaccgccgaggag
gcgacggaacggcttcggcaggcgctgaggtggctcgggggcggaccacaaagccccccg
aggtcgtga

DBGET integrated database retrieval system