KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_1436Help
Entry
Sulac_1436        CDS       T01746                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sap00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sap00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1414472..1415953
Genome map
AA seq 493 aa AA seqDB search
MTINEFANILSHAQVVGDGSVTVGGIQYDSRRVEKGDLFCAIPGFHTDGHLYCQEAYQRG
AVAFLVERADTVPKGAPALIVPEARPAMAIVADAFYGHPSGRLWMVGVTGTNGKTTTTHL
IRAVLEGSDIPCGLTGTLHTLIGQETFKVVRTTPEAPDLQRILRHMADRGMRAAVMEVSS
HALVLSRVDAVEYDVGVFTNLTQDHLDFHHDIESYFRAKALLFERLGTGRPKGPRAAVIN
RDDPYSERLMGMTGVPVLTYGIQQPSDIRATQVNITSRGVQFVAEFPEGVSQPVEFGMPG
RFNVLNALAAMAVGYVYGLTPSEMAESLARYPGVPGRFERIDEGQPFTVIVDYAHTPDGL
ENALKTAREFSLGKIGVVFGAGGDRDRGKRPLMGEVAGRLADWTVLTADNPRSEDPLDII
HQIAEGVNRVGGQWQQELDRERAIRLALNQAQPGDVVLIVGKGHETYQIYRDATIHFDDR
EVARQILRELNKG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaatgagttcgcgaatatattatcccatgcacaagtcgtcggcgacggttcg
gtgaccgtcggcgggattcaatatgattcccggcgggtcgagaaaggcgatttattttgt
gccattcccgggtttcacacagatggccatctttattgccaggaggcgtatcaacgggga
gcggtggcctttttggtggaacgggcggacacggtgccgaagggcgcaccggctctgatc
gtgccggaagcccgcccggccatggccattgtggcggatgccttttacgggcatccgtcg
ggccgcctgtggatggtcggggtgacgggcaccaacggaaaaaccacgaccacccatctg
attcgggcggtgttggaaggcagcgatatcccctgcgggttaacgggcaccctccatacg
cttattgggcaggagacgttcaaggtcgtgcgaaccacgccggaagcgcccgatctccag
cgaattctccgccatatggccgatcggggaatgcgggcggccgtcatggaagtatcgtcc
catgccttagtcctgtcgcgggtggatgcggtggaatacgatgtcggagtctttaccaat
ttgactcaggatcatctcgacttccaccacgacattgagagctatttccgggcgaaggcc
ctattgtttgagcgcctggggacggggcggccgaaaggtccgcgagccgcggtcattaac
cgtgacgacccgtattcggaacgtttaatggggatgaccggggtgccggttttgacctat
ggcattcagcaaccgtcggacattcgggcgacacaagtcaatattaccagtcgtggggtg
cagttcgtcgcggaattccccgaaggggtgtcgcaaccggtggaattcggaatgccgggg
cggtttaatgtgcttaatgccctggccgccatggccgtggggtatgtctacgggttgacc
ccatccgagatggccgaatctttggcccggtatcccggggtgcctggccgctttgagcgg
attgacgaggggcagccttttaccgtgattgtcgactatgcgcataccccggacggcttg
gagaacgcgctcaaaacggcacgggaattttccttagggaaaattggggtcgtcttcggc
gccggtggcgaccgagaccgcggcaagcggcccttaatgggcgaggtggccggtcggttg
gccgattggaccgtgttgacggccgacaatccccgttcggaagatccgctggatatcatt
catcaaatcgccgagggcgtgaatcgtgtggggggacaatggcagcaagagctcgatcga
gaacgggccattcgcctagcgctgaatcaggctcaaccgggtgatgtcgtgctcattgtc
ggcaagggccacgaaacctaccagatttatcgggatgcgaccattcacttcgatgatcgg
gaagtggcacgacaaattttaagggagcttaataagggatga

DBGET integrated database retrieval system