KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_1466Help
Entry
Sulac_1466        CDS       T01746                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sulac_1466
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sulac_1466
Enzymes [BR:sap01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Sulac_1466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1442670..1443587
Genome map
AA seq 305 aa AA seqDB search
MGHLIGIQAYSTGELQEILDQAQSFYRQLTQKPRQIPPALHGRTVVTWFMEPSTRTRASF
ELAARYLGAEVLSLATEGSSMVKGETLWDTLANLEAMGIDALVVRHAEAGVPWQLARRAR
VPVINAGDGWHEHPTQALLDLLTVRQALGDVSGLHVAIVGDILHSRVARSDIWGFTRMGA
TVTLVGPPQFVPSEWPAKGVRVSDELSEVLPSADVVILLRIQKERQALNGLFSVEEYRLR
WGLTAERFRILKPGAVVLHPGPQNRGVEIDSDVMAQDSVLIGRQVTNGVAVRMAVLSRLM
GEKTW
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggggcatcttatcgggatccaggcctattcgacgggggaattacaagagattttggat
caggcccaatccttctatcgccaacttacgcaaaagcctcgacaaatccccccggcgctg
cacggtcggacggtcgtgacctggtttatggagccgagcacgcgcacacgtgcgtctttt
gagctggcggcgcgctacttgggggcggaggtcctatccctggcgaccgaagggtcgagt
atggttaaaggcgaaacgctatgggacacgctggccaatttggaggccatgggtatcgat
gcgttggtggtgcgccatgcagaagcgggcgtcccctggcaactggcccgaagggcgcgg
gttcccgtgattaatgccggagacggctggcatgaacacccgacgcaggcgctcttggat
ttgttaacggttcggcaggcattgggggatgtctcgggtcttcacgtcgcgattgtgggt
gacattttgcacagccgggtcgcccgttcggatatttggggatttactcggatgggggcc
acggtgacattggtggggccgccgcaatttgttccgtccgaatggccagccaagggagtc
cgggtttcggacgagctctcggaagtcttgccttcggcggacgtggtaattttattaagg
attcaaaaagagcgacaggccctcaacggcctcttttcggtggaagagtatcgcttgcgg
tgggggctgactgctgagcggtttcggatattgaaacccggggcggtggtgctccatccg
ggtccgcaaaatcgcggggtggagatcgatagtgacgtcatggcgcaagactcggttctg
attggacgccaagtgaccaatggggtagcggtccgcatggccgtattgtcccggctgatg
ggggaaaaaacatggtaa

DBGET integrated database retrieval system