KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_1737Help
Entry
Sulac_1737        CDS       T01746                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sulac_1737
Enzymes [BR:sap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Sulac_1737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1691394..1692425
Genome map
AA seq 343 aa AA seqDB search
MKAGRIHAYHEPIHIDDINEPRIEKDTDVIVKIGGAGVCRTDLHIIEGIWKDALGNPPLP
YTIGHENAGWIEAVGSGITHLKKGDPVILHPLMSCGLCPACRAGRDMYCTQGHFPGLDGT
DGGYAEYLKTSVRSVIPLAPGTDPVPLAPFADAGITAYHAVKKLVPLTAPGTTVAVIGIG
GLGHFAVQILRALTPATVIAIDTQSQRLDFATEIGAHHAVLAGSDGGVGGVKRIAPNGVD
IVIDFVGEHQTPAAGVNMLAKGGTYSVVGYGGEVQVPTLEFVNREINIVGNLVGTYNELA
ELMELNRQGKVVISAQQFPLADAPQVMEMLDRGEIKGRAILIP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccggacgtattcatgcatatcacgaaccgattcacatcgacgacattaatgag
ccgcggatcgaaaaagacactgacgtgattgtgaaaatcggcggcgcaggggtatgccgg
accgatttgcatatcatcgaagggatctggaaggacgcgctcgggaaccctccccttccc
tacaccatcggtcacgaaaatgccggatggatcgaagcggtcggatccgggataacccat
ttgaaaaaaggcgatcccgttattttgcatcccttaatgtcttgcggcctttgtcctgcg
tgtcgggcgggacgcgacatgtactgcacccaagggcattttccgggattggacgggacc
gacggcggttatgccgaatacctcaagacgtcggtgcgctcggtaatccctttagcgccc
ggcaccgatccggtcccgttggccccctttgccgacgccggcattacggcctatcatgcg
gtcaaaaaattggtgcctttaaccgctccgggtactaccgtggctgtcatcggcattggc
ggattggggcatttcgccgtacagattttacgggcattgacccccgccacggtgatcgca
atcgatacccaatcgcagcgactggactttgctacggaaatcggtgcgcaccatgcggtc
ttggcaggatcggacggcggggtcggcggggttaaacggatcgctccgaacggcgtagac
atcgtcattgattttgtgggggaacatcaaaccccggccgccggagtcaacatgttggcc
aaggggggtacctattctgtcgtcggctacggcggtgaagtccaagtgccgacattggag
tttgtcaaccgggaaatcaatatcgtgggtaatttggtcgggacctacaatgagctggca
gaactgatggaactcaaccgtcaaggaaaggtagtgatatcggcccaacaatttcctttg
gccgatgccccacaggtgatggagatgctggatcgcggagaaatcaaagggcgggctatc
ctgatcccataa

DBGET integrated database retrieval system