KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_1826Help
Entry
Sulac_1826        CDS       T01746                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulac_1826
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sulac_1826
  Amino acid metabolism
   00310 Lysine degradation
    Sulac_1826
Enzymes [BR:sap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sulac_1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1767762..1768970)
Genome map
AA seq 402 aa AA seqDB search
MSELKVPELGESVVEATVGRWLKQEGEAVSPGEPVVELETDKVNLEVAAETAGVITKILA
PEGSTVAVGSSLATIEAGATAAPPAAVPPVSDSAPVVDEGVRATPDVRRLAKEQGVDLAR
LQGSGPKGRIVRDDVLAATKPPENPVLPPPPPRAPQPEPRALSPDAAWSERQEEHIPMSS
RRLTIARRLVEAQHQAAMLTTFNEVDMSTVLAVRQRRRDAFKERYGVSLGLMSFFTKAVI
GALKAFPRLNAEIRGQEMIIKHYYDIGIAVATDQGLVVPVLRNADRMTFAEIEQQVAELA
RRARDNKLTLDELKGGTFTITNGGVFGSLLSTPILNAPQVGILGMHKIQERPVAVNGQVE
IRPMMYIALSYDHRIVDGSEAVRFLVTVKQFIEDPEALLLEG
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgaattgaaggtaccggaattgggcgagtcggtggttgaagccaccgtaggccgt
tggttaaagcaggaaggggaggccgtctctccgggagaaccggtggtcgaactcgaaacg
gataaagtcaatttggaagtcgcggccgaaacggcgggcgtgattacgaagattctggcg
ccggaaggcagtacggtggcggtcggcagcagtctcgccaccatcgaggccggcgccacc
gccgccccgccggcggcggtccccccggtgtccgactcggcgccggtggtggacgaaggg
gtccgggcgacgcccgatgttcggcgattggccaaagaacaaggggttgatttagctcgg
ctccaaggctcgggtcccaaggggcgcatcgtccgagacgacgtcttggccgccaccaaa
ccgcccgagaatccggttttaccgccgccaccccctcgagctccgcaaccggaaccccgg
gccctatcacccgatgcggcgtggtccgaacggcaggaagaacatatccccatgtcgtct
cgtcggctgaccatcgcacgccgcttggtcgaagcgcaacatcaggcggccatgctcacc
acgtttaacgaagtcgacatgtctacggtgctcgccgtccgtcagcgtcgacgagacgcg
tttaaagaacggtacggtgtgagtcttggattgatgtcgttttttaccaaggcggttatt
ggcgccttgaaagccttcccgcggttaaacgcggaaatccgtggtcaggaaatgattatt
aagcattactacgatatcggcattgccgttgccaccgatcaaggcttagtcgtcccggtg
ttacgaaacgccgaccggatgacgtttgccgagattgagcaacaggttgcggaattggcc
cgccgggcccgcgacaataagctgacgttagacgaactgaaaggcggcacgtttacgatt
accaacggcggggtgtttggatcacttttgtcgacgcctatcttaaacgccccccaagtc
ggcatcttgggcatgcataaaattcaagagcgtccggtggcggttaacggccaagtagag
atccggccgatgatgtacatcgccttgtcctacgaccatcggattgtggacggaagtgaa
gccgttcggtttttagtgaccgtcaagcagtttattgaagaccccgaggccttgttgttg
gaggggtag

DBGET integrated database retrieval system