KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_1911Help
Entry
Sulac_1911        CDS       T01746                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00900  Terpenoid backbone biosynthesis
sap01100  Metabolic pathways
sap01110  Biosynthesis of secondary metabolites
sap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sulac_1911
Enzymes [BR:sap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Sulac_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AEW05403
UniProt: G8U0V0
Position
complement(1857439..1858605)
Genome map
AA seq 388 aa AA seqDB search
MAPIRLIILGATGSIGQNARAVLEEHRDKIQVEGLVARSRFEAVHDFALAFDARWVGLTD
PAAADRLRQFAPDRPYRLITGMEEVVETIHESSATTVLAAMSGFSGLRPTLAALERGMTV
LLANKETLVAAGDLVKGVAAAHAAPLVPVDSEHSAIFQCLGLDQPVRRIILTCSGGPFRG
MTREQLRHVTVEQALAHPNWRMGPKITVDSATLMNKGLEIIEAHHLFNTPFDQIDVVVHP
ESVIHSLVEFVDGATLAQLGWPDMRVPIQVALSWPDRWPLSGAPLSLTDRPLTFMPPDEE
AFPALRLARQAGIAGGLYPAVLNAANEEAVAAFLARDIAFLDISRVVEHTLSVFSDTRPA
TTLEDILATDRWARQTAAAWIHERARTP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcacctattcgcctcatcattttaggagctaccgggtcgattggtcaaaacgcccgg
gcggtgctggaagaacaccgggacaaaattcaagtggaggggcttgtggcccggtcgcgc
tttgaggccgtccacgactttgccctggcatttgacgcccgttgggtcgggctgaccgat
ccggccgcagccgaccggctgcgccaattcgcgccggatcggccctatcggttaatcacc
ggaatggaagaggtcgtagaaacaattcatgaatcgtcggccacgacggtgctggcggcg
atgagcggtttttcggggctgcgtccgaccttagccgcattagagcgaggcatgaccgtg
ttgctggccaacaaggagacgttggtggcggccggcgacttggtaaagggggtggccgcg
gcccacgctgcgcccttggttcccgtcgacagcgaacattccgccattttccaatgtctt
gggttagaccaaccggtacggcgcattatcttaacctgttcggggggaccctttcggggg
atgacgcgcgaacagctccgccacgtgacggtggaacaggcgttggcccatcccaattgg
cgaatggggccgaagattaccgtggactcggcgactttaatgaataaagggcttgaaata
atcgaagcccaccatcttttcaacacacctttcgaccaaattgatgtcgtggtccacccg
gaaagcgtcatccattcgttagtggagtttgtggacggtgccactctggcccagctcggt
tggcccgatatgcgggtgccgattcaagtggcactgagttggcctgaccgctggccttta
agtggcgccccattatcgctgacggaccgtccgctgacgtttatgccgccggacgaggag
gcattcccggcccttcggttggcccggcaggccggcatcgcaggaggcctctacccggcg
gtccttaatgccgccaacgaagaggccgtggccgcgtttctcgcccgggacatcgccttt
ttggacatttcccgcgtggtggaacataccctctcggtgttttccgatacccggcccgcc
accaccctcgaagacattctcgcgaccgaccgatgggcacggcaaacggcggccgcctgg
attcacgaaagggcccgtacaccctga

DBGET integrated database retrieval system