KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2024Help
Entry
Sulac_2024        CDS       T01746                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sulac_2024
Enzymes [BR:sap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Sulac_2024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1969769..1972087
Genome map
AA seq 772 aa AA seqDB search
MPQFEFHHRSFWLDGTPFVPFGGEFHYFRADPAHWADRLKAMRDLHINLLSTYIPWIWHA
PHPDVIDFRGRSHPQRNLIRFIELAHQAGLLVFIRPGPYVMAELRQEGIPAWVSDRYPEV
LAQGPGGQRHPTGMVSYLHPTFLQLVKKWYEAVADALRPYFAENGGPIVMTQLDNEVGML
HWVSQLPDQRTDITPELPLDVQAAPGHAAYWQAAEYWSAYRAQYLHTLHDWAEAFGFPRP
FVVNVHGFRDFSVYSRGVDYPVGLAQLEKTHRLADTVLGGDFYPGHVTYDNFHDLVLAAL
FTNAVNRPEAPGFSPEFQSGRFQDRPHIDPSDLDLAARATLAAGFNGINWYMLVGGQNPE
NIGLFGSRHLWQAPLPETGDSRPSAAVVGHLGALLATYHASLPLTRPVSEVTLGFYPPYY
LTDTNPDAYPDTTGIVTQIIHQRQHEQFDGVARMLVAANLVLDAQVVNRPDALSGVEVLF
LPATRYLDRSTQERLVDYVHEGGTLILGPDIPDRDLDGHPVTVLRDGLQLPEPVEEGHRG
LISVLDWHSIYAPRYWAFSPQQEAERLAFVEGQPEKWVAFRRVAGRGSVTVLGCGCSDSY
DYYHAVMRDLLARLGIPGALSTSNTRLHVTYRQTPSNQAPAGFLFVQNYHDSEENAAIRL
YTPQKTYVWEVMLNPRQGLMLPFGGIEVVPGHLAVQSTTAEMTFDGEVLAIHRGPTAGHA
QLTRQPGASCDVLLLQGSATVAHHPDAIDIQWSSQSCPRPILLLTRRNVSMT
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgccacaatttgaatttcatcatcgatccttttggctcgacggaacgcctttcgtgcca
tttggcggagaattccactatttccgggccgatcccgcccattgggcggaccggctaaag
gccatgcgcgacctccatatcaatttgctcagtacctatattccctggatttggcacgca
ccccatccggacgtgatcgattttcgcggacgaagccatccccaaagaaatctgattcgt
tttattgaactggcccaccaagccgggctcttggtgttcattcgcccgggcccttatgtg
atggccgaactaagacaagaaggcattccggcttgggtgtcggaccgttatcccgaagtg
ttggcccagggtccaggtgggcaacgtcatccgaccggcatggtatcctaccttcacccg
acgtttttgcaattggtgaaaaagtggtatgaagccgttgccgatgcccttcgcccctat
tttgcggaaaacggcggtcccattgtcatgacccaactggataacgaggtgggcatgctc
cattgggtcagtcaattgccggatcagcggaccgatatcacccccgaattgccgttagat
gttcaggcggcgcccggtcacgccgcctattggcaagcggcggagtattggtcggcatat
cgggcccagtatcttcatacgttacatgactgggccgaagcgttcggattccctcggccc
ttcgtcgtcaacgtccacggatttcgcgacttctcagtatacagtcggggcgtggactac
cccgtcggcttggcccaattggaaaaaacccatcgattggccgataccgtcttggggggg
gatttttatcccggtcacgtcacctatgataactttcacgatctcgttctggccgccctt
ttcaccaacgcggtaaatcggccggaggcaccgggtttttcacccgaatttcaatcgggg
cggtttcaggaccgaccccatattgacccgtcggacctggacttggccgcacgcgcgacc
ctggcggccggattcaacgggattaactggtatatgctggtcggcgggcagaaccccgaa
aatattggccttttcgggtctcgccatctgtggcaagcacctttaccggagaccggcgac
agtcgcccctcggcggccgtcgttggccatctgggagcgcttttggcgacgtatcacgcc
agcttgccgctaacgcggcccgtctccgaggtcaccctggggttttatcccccctattac
ctcaccgacaccaacccggatgcctatcccgacacgaccgggattgtgacccaaatcatt
caccagcggcagcatgagcagttcgacggcgtcgcccgcatgctggtggccgctaacctg
gttctagacgcccaagtggtcaatcgacccgatgcactcagcggcgtagaggttctcttt
ctgcccgccacccgttatctggaccgctcgacgcaagaacggttggtcgattatgtccat
gaagggggcacgttgattttggggcccgacatccctgatcgggacctggacggccatccc
gtcacggtgttacgagacggcctgcaactccccgaacccgtcgaggagggccacagagga
ctcatctcggtgctggattggcacagcatttatgctcctcggtattgggcgttctccccc
cagcaggaggcggaacggctcgcgtttgtggaaggacagcccgaaaaatgggtggcgttt
cgacgggttgcgggtcgcgggtcggtcaccgttctcgggtgcgggtgctcggacagttat
gactattatcatgccgtgatgcgcgatctgttggctcggttgggcatccccggggccctc
agtacaagcaacacccggcttcacgtcacctatcggcaaaccccatccaatcaggcacct
gccgggtttctctttgttcagaattatcacgacagcgaggaaaatgcggccattcggctt
tatacgccccaaaaaacttacgtatgggaggtgatgctcaatccgcggcaaggactcatg
ttgccctttggaggcatcgaggtggtacccggacatctggccgtccaatccaccaccgcg
gaaatgacattcgacggagaggtcttagccattcatcgcggaccgaccgccggtcacgca
cagctaactcgacaacccggtgcatcctgcgacgtccttctgttgcagggatccgccacg
gtcgctcatcatccggatgctattgacattcaatggtcatcccagagctgtccgcgaccg
attttgttactcactcggcgaaacgtttcgatgacttaa

DBGET integrated database retrieval system