KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2211Help
Entry
Sulac_2211        CDS       T01746                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sap00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sap00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2174249..2175583)
Genome map
AA seq 444 aa AA seqDB search
MVKITLVGAGSMHFTRDLIWNLLLHPQADRIEWRLFDIDADRLRISYRLVQEIGRQLHVT
PRAVTVDTQREALQGADFVINVVQVGGFEATRRDFDIPERYGIVQTIGDTLGVGGIFRAL
RTIPVVLDLVRDMEDVCPEAVLLNYTNPLSMVVMAIARISGIQAYGLCESPRTTADTLSR
YLEIPPDRLNWMTAGINHMAWVLRLEAEGRDLYPTLRSLADDPETWRKDAVRFELMKAFG
YFVTESSEHNAEYGPWFITHPDEIRRLGIPLGELLRRSANYLRDFEAYKTEGIREDFTFP
RHPPFQYAAELITHWMTGEDLTFYGSVMNHGLIDNIMPTIAVEVPCVLTQGEIFPVHVGP
LPDVLAALNNRAGAIQDLTVQAVLRRNREDLYHALLLDPVVSSRLTVDQTVSLANELLEA
HKGIVPELKTRRVFGNTSFSGEGT
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaattacgctcgtcggcgccggaagcatgcattttacccgtgatttgatatgg
aatctattattacatccccaggcggaccggattgaatggcggttatttgatatcgatgcc
gaccggttacggatttcgtatcgtctggttcaggaaatcggccgtcaacttcacgtaaca
cctcgggcggtgaccgttgatacgcaacgggaagctttgcagggggcggattttgtaatc
aacgtggttcaagtaggcggatttgaggcgacccgacgggattttgacatacccgaacgg
tacgggatcgtccagactatcggggataccctgggggtcggcgggattttccgtgcgctt
cggaccattccggtggtgcttgatttggtccgagatatggaagacgtatgtccggaggcc
gtcttgttaaactacacgaacccgttgtccatggtcgtcatggcaattgccaggatcagc
ggcatccaggcgtacgggctatgtgaaagtcctcgcaccaccgcggacactttgtcccgc
taccttgaaattccgccggaccggttaaactggatgaccgccggcattaaccacatggcg
tgggttctccgattggaggcggagggccgggacctatacccgacattgagatcgttggcc
gatgatcccgagacctggcgaaaggatgcggtgcgattcgaattaatgaaagcgttcggc
tatttcgtgaccgagtcgagcgaacataacgccgaatacggtccttggttcataactcac
cccgacgagattcggcgcctgggcattccccttggcgaactgctgcggcgaagcgccaac
tatctccgcgacttcgaggcctataaaaccgagggtattcgcgaagattttacttttccg
agacacccgccttttcaatatgccgccgagctgatcacacattggatgactggagaagac
ctgacgttttacggtagcgtcatgaatcacggcttaatagacaacatcatgccgaccatt
gccgtggaggttccctgcgtattgactcaaggtgagatttttccggtgcatgtgggcccc
ttgccggacgtgctggcggctttgaataatcgcgccggtgcgattcaggatctgacagtt
caggcagtgcttcgacgtaaccgggaggacttgtatcatgccttgttattggacccggtc
gtgtcgagccgattaaccgtggatcaaaccgtttcgttggccaacgagttgttggaggcc
cataaggggatcgttcccgaacttaaaacccgtcgcgtcttcgggaacacgtcattctcc
ggggagggtacatga

DBGET integrated database retrieval system