KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2211Help
Entry
Sulac_2211        CDS       T01746                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sulac_2211
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sulac_2211
   00600 Sphingolipid metabolism
    Sulac_2211
Enzymes [BR:sap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Sulac_2211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2174249..2175583)
Genome map
AA seq 444 aa AA seqDB search
MVKITLVGAGSMHFTRDLIWNLLLHPQADRIEWRLFDIDADRLRISYRLVQEIGRQLHVT
PRAVTVDTQREALQGADFVINVVQVGGFEATRRDFDIPERYGIVQTIGDTLGVGGIFRAL
RTIPVVLDLVRDMEDVCPEAVLLNYTNPLSMVVMAIARISGIQAYGLCESPRTTADTLSR
YLEIPPDRLNWMTAGINHMAWVLRLEAEGRDLYPTLRSLADDPETWRKDAVRFELMKAFG
YFVTESSEHNAEYGPWFITHPDEIRRLGIPLGELLRRSANYLRDFEAYKTEGIREDFTFP
RHPPFQYAAELITHWMTGEDLTFYGSVMNHGLIDNIMPTIAVEVPCVLTQGEIFPVHVGP
LPDVLAALNNRAGAIQDLTVQAVLRRNREDLYHALLLDPVVSSRLTVDQTVSLANELLEA
HKGIVPELKTRRVFGNTSFSGEGT
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaattacgctcgtcggcgccggaagcatgcattttacccgtgatttgatatgg
aatctattattacatccccaggcggaccggattgaatggcggttatttgatatcgatgcc
gaccggttacggatttcgtatcgtctggttcaggaaatcggccgtcaacttcacgtaaca
cctcgggcggtgaccgttgatacgcaacgggaagctttgcagggggcggattttgtaatc
aacgtggttcaagtaggcggatttgaggcgacccgacgggattttgacatacccgaacgg
tacgggatcgtccagactatcggggataccctgggggtcggcgggattttccgtgcgctt
cggaccattccggtggtgcttgatttggtccgagatatggaagacgtatgtccggaggcc
gtcttgttaaactacacgaacccgttgtccatggtcgtcatggcaattgccaggatcagc
ggcatccaggcgtacgggctatgtgaaagtcctcgcaccaccgcggacactttgtcccgc
taccttgaaattccgccggaccggttaaactggatgaccgccggcattaaccacatggcg
tgggttctccgattggaggcggagggccgggacctatacccgacattgagatcgttggcc
gatgatcccgagacctggcgaaaggatgcggtgcgattcgaattaatgaaagcgttcggc
tatttcgtgaccgagtcgagcgaacataacgccgaatacggtccttggttcataactcac
cccgacgagattcggcgcctgggcattccccttggcgaactgctgcggcgaagcgccaac
tatctccgcgacttcgaggcctataaaaccgagggtattcgcgaagattttacttttccg
agacacccgccttttcaatatgccgccgagctgatcacacattggatgactggagaagac
ctgacgttttacggtagcgtcatgaatcacggcttaatagacaacatcatgccgaccatt
gccgtggaggttccctgcgtattgactcaaggtgagatttttccggtgcatgtgggcccc
ttgccggacgtgctggcggctttgaataatcgcgccggtgcgattcaggatctgacagtt
caggcagtgcttcgacgtaaccgggaggacttgtatcatgccttgttattggacccggtc
gtgtcgagccgattaaccgtggatcaaaccgtttcgttggccaacgagttgttggaggcc
cataaggggatcgttcccgaacttaaaacccgtcgcgtcttcgggaacacgtcattctcc
ggggagggtacatga

DBGET integrated database retrieval system