KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2263Help
Entry
Sulac_2263        CDS       T01746                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sap00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sap00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2237957..2239573)
Genome map
AA seq 538 aa AA seqDB search
MHETEQWRFWAGQVLMAGFHGTEPNRAIRDLIQSHHVGNIILFSRNVADARQLQSLTAGL
QELAREAGQQWPLLIATDQENGMVRRLPPDIPGLPGNMALAATGDPALVQEVGMVTGQLL
RAVGINMDLAPVLDVNNNPDNPVIGVRSYGDRPDRVARFGSAMLRGLEAGGVLACGKHFP
GHGDTVVDSHRALPEIPHDWERLQQVELPPFIHAMRDGLDAVMTAHIVFRAVDSRPATLS
EPILTGWLRDIFGFNGVILTDCLEMDAIQKTVGVAQGAVDALKAGADIVLVSHSRHQQLA
ALNAIVAAVALGELPPSRLQEAAHRVQTLKSRRLGDWNSYRAFLEYEPWQDLTAKAALQK
RASSLAVTWLSRGDALPLSASSIRRIAVLYDETGSPMVPAGSENPVGQALVQTVRAVLPG
AEVHRYGFPAILHHESPTVLRQRIARADVIISGLNGTQNRLYLEFVRSIQSLTIPQVIFL
LRSPYDARAVADAPHILALYETTPWMYEAGVRAIVGGEARGRLPVEVIPVFSRDHAAG
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaaacggaacaatggcgtttttgggccggtcaagtccttatggcgggatttcac
ggcacagaacccaaccgggctatccgggatctgattcaatcgcatcacgtgggcaatatc
attttattttcccgcaatgtcgccgatgcccgtcaattgcaatcgctaacggcgggatta
caagaattggctcgggaggccggtcaacagtggccgcttttgattgctaccgaccaagaa
aacggtatggtccggcggttgccgccggatatcccgggacttccgggcaatatggcgtta
gcggctaccggagatcctgcattagtgcaggaagtcggcatggtgacgggtcagctgtta
cgcgcggtgggcatcaacatggacttggctccggtgctggacgtgaataacaatccggac
aacccggtcattggggtacggtcatatggcgatcggcccgatcgcgtggcccgattcggc
tcggcgatgttacgggggcttgaagccggcggcgtcttggcctgtggtaaacattttccg
ggccatggggacacggtggtggattcacatcgggcgttgccggaaattccccacgactgg
gagcgattgcaacaggttgagcttccgcctttcatccatgcgatgcgagacggattggat
gccgtgatgacggcccatattgtgtttcgagcggttgacagccgaccggccacgttgtcg
gaaccgattttaaccggttggttgcgagacatcttcggatttaacggggttatcctgacc
gattgcctagaaatggatgcgattcaaaagaccgtcggggtagcccaaggggcggtggac
gcgctcaaagccggcgctgatatcgtgttggtgtcccattcccgccatcagcaactcgcg
gcgttgaacgccattgttgccgcggtcgcgttaggcgaattgccgccgtcccgactacaa
gaagcggctcaccgggtccagacattgaaaagtcggcgcttaggggattggaacagttat
cgggcctttctagaatatgagccttggcaggatttgacggccaaggctgcgttgcaaaaa
cgggcttccagcctggccgtgacctggctttcgcggggggacgcgttgccgctgtcggca
agttccattcggcggatagcggtcctttacgacgaaacgggctctccgatggtcccggcg
ggatccgagaatcccgtcgggcaagcattggtccagaccgtgcgtgcggtgctacccggg
gcagaggtgcatcgctacgggtttcccgccatcctccatcatgaatcacccaccgtgctc
cgacaacggatcgctcgagcggacgttatcattagcggtcttaacggaacccaaaatagg
ctttatctagaatttgtgcggtccattcaatcgctgaccatccctcaagtaattttttta
ttgcgtagtccctatgatgcgcgagccgtggccgatgctccgcatattttagcgctttat
gaaaccaccccgtggatgtatgaagccggcgttcgggcgattgtgggcggcgaggcgcgg
ggacgactgccggtagaggtgattccggtgttttctcgcgatcatgcggcagggtga

DBGET integrated database retrieval system