KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2486Help
Entry
Sulac_2486        CDS       T01746                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulac_2486
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sulac_2486
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sulac_2486
Enzymes [BR:sap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sulac_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2462754..2463560)
Genome map
AA seq 268 aa AA seqDB search
MNQRIQEAFVRARAEGRAALIPYLTAGYPRLDLLPDLVQAVSEAGADIIEIGIPFSDPLA
DGPVLQQAATIALANGTKIKDIFSVVAQLVPKAPPLVFLTYINPVFHMGMEVFVTHMREA
GVEGVIIPDLPWAEAEEMRTVTRSQGVALIPLAAPTSTDRHLKAIQHEGDGFVYGVSLTG
VTGVRDTLDAGVGELVRRIKAAGPLPVAMGFGISTPEQAHTVAQIADGVIVGSALVKHLQ
THPDMAVQAAYEFVRDLRNAVKIPISKA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcgtatccaggaggcgtttgtacgagctcgtgccgagggacgggccgcctta
attccctatttaacggccggctatccgcggctggacttgttgccggatttggtgcaggcg
gtttcggaggcgggggccgacattattgaaatcggcatcccgttctccgatccgttggcg
gacggaccggttttgcaacaggccgcgacgattgcgctggcgaacgggacgaaaatcaag
gatattttttccgtcgtggcgcaattggtccccaaagccccgccgctggtctttttgaca
tatattaacccggtttttcatatggggatggaagtattcgtaacccatatgcgtgaagcc
ggggttgaaggggtaatcatccccgacttgccttgggcggaggccgaggagatgcgcacc
gtgacccggtcccagggggtggcgctgattcctttggccgcaccgacctccaccgatcgg
cacctcaaagccatccaacacgagggggatggatttgtctatggggtgtctttgaccggg
gttaccggggtacgggataccctggatgcgggagtcggtgaattagtccgccgcattaag
gcggccggacctttgccggtggccatgggattcgggatatcaacccctgaacaggcccat
accgtagcgcaaattgctgatggggtcattgtcggtagcgcattggtgaaacatttgcaa
acgcatcccgatatggccgtgcaggcggcctatgaatttgtgagggatctgcggaacgcg
gtaaaaattcctatctcgaaggcttga

DBGET integrated database retrieval system