KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2487Help
Entry
Sulac_2487        CDS       T01746                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulac_2487
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sulac_2487
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sulac_2487
Enzymes [BR:sap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sulac_2487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2463560..2464768)
Genome map
AA seq 402 aa AA seqDB search
MATRVHKEEWPDQHGRFGRFGGRYVPETLMPAIEELEQAYRAARRDREFQKEFQSLLKDY
VGRPTPLRRADQMSAALGFDVYLKREDLNHTGAHKINNTIGQVLLARKMGKTRIIAETGA
GQHGVATATAAALFGLKAEVYMGREDVHRQALNVYRMKLLGAEVHAVDSGTKTLKDATNE
ALRDWVTNVRTTFYVIGSVVGPHPYPMMVRDFQSVIGREARRQYLALTGSLPTHIVAAVG
GGSNSMGIFYPFRHDPVALVGIEAAGEGIETGRHAASIHQAEPGILHGSLSYLLQDEDGQ
IQPAHSISAGLDYPGVGPEHAHFHDTGRATYEAITDQEALDAFYRLSRWEGIIPALESAH
AVAWVIKEAPRLKEQHARVLINLSGRGDKDIDAVLRYERGEA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcgagtgcataaagaggaatggcccgatcaacacggccggttcggccgcttt
ggcggccggtatgtgccggaaacgttgatgccggcgattgaggagctggagcaggcctat
cgtgcggctcgacgggaccgggagtttcagaaggaatttcaaagcctattgaaagattac
gtcggacgaccgacaccgcttcgacgggccgatcaaatgagcgcggctctgggatttgat
gtctatctgaaacgggaagatttgaaccatacgggtgcccataaaattaataacacgatc
ggccaggtgctcttagcccgtaaaatgggtaaaacgcggatcattgcagaaaccggggcc
gggcagcatggcgtggcaacggccacggcggcggcgctgtttggcctcaaggcggaagtt
tacatgggccgggaggatgtgcatcgacaggccctcaacgtgtaccgcatgaagctttta
ggagcggaagtgcacgccgtcgactccggcaccaaaacgctgaaagacgcgaccaacgaa
gcattgcgcgattgggtgaccaacgtgcgtacgaccttttatgtcattgggtcggtcgtg
ggaccgcatccttacccgatgatggtccgggattttcaatccgtgatcggccgggaggcc
cgtcggcagtacctggctttgaccgggtcgttgccgacccacattgtggccgcggtcggg
ggcggatccaacagcatggggatcttctatccgtttcggcatgatccggtggcgctggtc
ggtatcgaagcggccggcgaaggtattgagaccggtcgccatgccgccagcatccaccaa
gcggaacccggtattttgcatggcagcctgagttatctcctgcaggacgaagacggtcaa
atccagccggcgcattcgatttcggccggtctcgactatcccggggtgggcccggagcac
gcccactttcatgataccggtcgggcgacctatgaggcaatcaccgatcaggaggcgctc
gacgctttttaccggttgtctcgctgggaagggatcatccctgcgcttgaaagtgcccac
gcggtcgcttgggtcatcaaagaggcgccccgcctcaaagaacagcacgctcgggtgctc
atcaatctatcgggccgtggcgataaagacattgatgcggttttgcgctatgagaggggg
gaggcgtaa

DBGET integrated database retrieval system