KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2489Help
Entry
Sulac_2489        CDS       T01746                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sap01100  Metabolic pathways
sap01110  Biosynthesis of secondary metabolites
sap01130  Biosynthesis of antibiotics
sap01230  Biosynthesis of amino acids
Module
sap_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sulac_2489
Enzymes [BR:sap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sulac_2489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth ThiG FMN_dh Glyco_hydro_20 DUF1192
Motif
Other DBs
NCBI-ProteinID: AEW05951
UniProt: G8TW24
Position
complement(2465299..2466066)
Genome map
AA seq 255 aa AA seqDB search
MFLDRIVASVDARVEALRDEWARLEEKAQNMPPTRSLADALRADPGTLQVIAECKQRSPS
KGWLTDHYDPVAQAQGYQRAGAAAISVLTEPEFFAGDLAHLRAVREAVSIPVLRKDFIRH
PVQIAEARAAGADAVLLIIRILEPDQYRALYDYATRLGLDVLVEIHSPVEAEVALTAHPA
IIGVNNRDLDSFETRLSFSQEMALALGPDIIKVSESGIHQVEDLRQVRDWGYQAVLVGEA
LMRGRPLLEEWRANG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaccgaattgtggcgtccgtcgatgcgcgggtcgaggcccttcgggacgaa
tgggcgcgactcgaagaaaaggcccaaaacatgccgccgacccgctcgctggccgatgcg
ttacgggccgatccggggacgcttcaggtgattgccgaatgcaagcaacgatcgccgtcc
aaagggtggttaaccgaccattatgacccggtcgcgcaagctcaaggctaccaacgggcg
ggggcggccgcgatatccgttctcaccgaaccggagttttttgccggcgatcttgcccat
ttgcgggcggtgcgggaagcggtatcgattccggttttacgtaaagacttcattcgccac
ccggtgcagattgcggaggcgcgggcggccggcgccgatgccgtgttattgattatccgc
attttggaaccggaccaatatcgagcgttgtatgattatgccacccgattggggcttgat
gttctggttgaaattcattccccggtggaggccgaggttgccttgaccgctcacccggcc
attatcggggtgaataaccgcgatttggactcttttgagacgcgtctgtctttttctcag
gaaatggctttagcgttggggccggacattatcaaagtcagcgaaagcggcattcatcag
gtagaggatttgcgccaggtccgggactgggggtatcaggccgtattagtgggagaggcc
ctgatgcgcggccgtccgttgttggaggaatggcgtgctaacggttaa

DBGET integrated database retrieval system