KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2562Help
Entry
Sulac_2562        CDS       T01746                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sulac_2562
Enzymes [BR:sap01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Sulac_2562
Peptidases [BR:sap01002]
 Cysteine Peptidases
  Family C44
   Sulac_2562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2531060..2532904
Genome map
AA seq 614 aa AA seqDB search
MCGIAGWIDWQQNVVAHQRDLENMAAPMTCRGPDGSGSWVTPRAGLAHRRLIVIDPEGGM
QPMSKREHGHVYTIVYNGELYNFQELRQQLTALGHTFRSRSDTEVLLTAYMAWGEGALER
LNGIYAFAIWDSDRQTLFLARDRLGVKPLFYAQTPSGLVFASEIKGILAHPAIRPEVDRT
GLAEIFTLGPARTPGHAIFRQIRELRPGEYAIYRPSGLTVRPYWHLESHPHPDSVEKTAE
TIEALLWDAVEKQLVADVPVVTLLSGGLDSSLVTAMAQKAFREQQKDALGTFSIQFKDMA
RYFRDNGFQTNLDDPWVTRVAEFLETTHQRVELDTPELDEYLIPALLARDVPGHADVDTS
LLVFAQHIKERATVGLSGEAADEIFGGYPWFHRADALAAHTFPWSLRLRDRIRVLAPELI
DYLKPEQYVQDRYDEALAEVPHLAGESPESARIREIAYLSITRFLPTLLERKDRMTMAAS
LEVRVPYCDHRLVEYVWNIPWEMKNYGGHPKGILRLAAERWLPSDVVYRRKSPYPSTVNP
SYFYRMADRLQAILEDTHSPLRPLVNQTVLRNMIAAGPDAAQIPWFGQLMGNAQLFAFLI
QTDAWLRHYHVTFV
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatagccggctggatagattggcaacaaaacgtggtcgcccatcagcgcgat
ctggagaacatggcggcccccatgacctgccgcggcccggatggtagcggaagctgggta
acgccgcgggccggtttggcgcaccgtcggctgatcgtcatcgaccccgaaggcggcatg
caacccatgtcgaaacgcgaacacggtcatgtatataccattgtttataatggggaactg
tataattttcaagaactccgccaacaactcaccgccctcggccataccttccgcagccgt
tcggacacggaagtcttgttgaccgcctacatggcttggggagaaggggctttggaacgg
ctgaacggcatctatgcgttcgcgatttgggacagcgaccggcaaaccttgtttcttgct
cgcgatcggttgggcgtcaagcctttgttctatgcccaaaccccgtcgggcctggtgttc
gcctcggaaatcaaagggattttagcccacccggccatccgaccggaagtcgaccgcacg
ggcttggccgaaatctttaccttgggtccggcgcgcaccccggggcatgcgatctttcgg
cagattcgagagcttcgcccgggtgagtatgcgatttaccgcccttccgggttaaccgta
cgaccctattggcacttggaaagccatccccatcccgattcggtcgaaaaaaccgcagaa
accattgaagccttgttgtgggacgcggtcgaaaagcaattggtggcggatgttccggtg
gtcacccttctctccggcgggttagactccagcttggtcaccgccatggcccaaaaagct
tttcgggagcaacagaaagatgctctagggacattttccatccaatttaaagatatggcc
cgctattttcgggataacgggtttcagaccaatttggacgatccctgggtcacccgcgtg
gccgaattcctggagacgacgcatcagcgggtggagttggacactcccgagctggatgag
tacctcattccggctcttctggctcgcgatgtccccggccacgccgatgtcgacacctcg
cttttggtcttcgcccagcatattaaagaacgcgcgacggtgggcctctccggcgaagcc
gccgacgagattttcggcggttatccttggtttcaccgtgccgatgctctcgccgcccat
accttcccctggtcgctaaggctccgcgatcgtatccgcgtattggcccccgagctcatc
gactatctaaaaccggaacagtatgtccaagatcgctatgacgaagccttggccgaagtg
ccccacctggccggggagtcgccggagtcggcccgcattcgagaaattgcctatctcagc
atcacccggtttttacccacgttattggaacgcaaagaccggatgaccatggcggccagc
ctcgaggtgcgagtcccctactgtgatcatcgcctcgtggaatatgtttggaacatcccc
tgggagatgaaaaactatggcggtcaccccaaagggattttacgattggccgcggaacgc
tggctgccttcggatgtggtctaccgccgcaaatcgccctatccgtcgacagtgaacccg
agctatttttatcgcatggctgatcggctccaagcaatactggaggatacccactcgcct
ttgcgaccgctcgtgaatcagacggtactacggaacatgatcgccgccggccccgatgcc
gcgcaaattccttggtttggccaactgatgggcaatgctcagctctttgcctttttgatt
caaaccgatgcgtggctccgccattaccacgtgacgttcgtctaa

DBGET integrated database retrieval system