KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2595Help
Entry
Sulac_2595        CDS       T01746                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00010  Glycolysis / Gluconeogenesis
sap00052  Galactose metabolism
sap00500  Starch and sucrose metabolism
sap00520  Amino sugar and nucleotide sugar metabolism
sap00521  Streptomycin biosynthesis
sap01100  Metabolic pathways
sap01110  Biosynthesis of secondary metabolites
sap01120  Microbial metabolism in diverse environments
sap01130  Biosynthesis of antibiotics
sap01200  Carbon metabolism
Module
sap_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulac_2595
   00052 Galactose metabolism
    Sulac_2595
   00500 Starch and sucrose metabolism
    Sulac_2595
   00520 Amino sugar and nucleotide sugar metabolism
    Sulac_2595
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sulac_2595
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sulac_2595
Enzymes [BR:sap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sulac_2595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEW06057
UniProt: G8TWR8
Position
complement(2565777..2566739)
Genome map
AA seq 320 aa AA seqDB search
MGEYLAVDVGGTKIAIGLGTDTGQLLETAILKTPAEKAPQDVLDQIADQALAMVHRHGVA
LEAVGVGSPGPLDGPVLLKTSNLSHWEGLNWETGLNTRLHVPVYVENDATAAAVGEWMFG
AGKGTRDLVYVTISTGIGAGFVVNGRVMSGFRGNAGEFGHLVLDPAGPWCPAGHYGCVES
YASGSALTREGRRHQKESPYLDGKESVDAKTVLQGWMRDDPVCGQIVDAATERLGRGLSY
LIDLMNPERIIVGGGVGVNAPERYLTMIESYARQYALPAMMAVVQFRRAQLGEQSGVMGA
LAVAINRQHNPNSLGHAKES
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagtatctggcagtggatgtaggcggcacgaaaattgccatcgggctcggtacc
gacaccgggcagctattagagacagcgatcctgaaaactcccgcggaaaaagcgccccag
gacgttttagatcagattgccgaccaggcgctggcgatggtccatcgccacggggtggcc
ttagaggcggtcggggtcggctcgccgggcccgctcgacggtccggtattacttaaaacg
tccaatttaagccactgggaaggcctcaattgggagaccgggctcaatacccgcctacac
gtaccggtctatgtggaaaacgacgcgaccgccgcggccgtcggcgaatggatgttcgga
gccggcaaaggaacgcgcgacttagtgtacgtgaccatatccacgggaatcggggccggc
tttgtcgtaaacggacgcgtcatgtcaggttttcggggcaatgccggcgaatttgggcat
ctggtgcttgatccggccgggccttggtgtcctgccgggcactacggttgtgtggaaagt
tatgcctccgggtcggccctgacgcgggaagggcggcgtcatcaaaaagaaagcccctat
ctcgacggcaaggagagtgttgacgccaaaaccgtcctgcaaggatggatgcgggacgat
ccggtgtgcggacaaatcgtggacgcggcgaccgagcggttggggcgaggattatcttat
ttaattgatctgatgaatccggagaggattatcgtcgggggcggcgtcggcgtgaacgcg
cctgagcggtatctgacgatgattgagtcctatgcccggcaatatgccttgccggccatg
atggcggtggtgcaatttcgtcgcgcgcaattgggcgaacagtcgggggtcatgggcgct
ttggcggtggccattaatcgccagcataacccgaattcattgggtcatgctaaagaaagc
taa

DBGET integrated database retrieval system