KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2595Help
Entry
Sulac_2595        CDS       T01746                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:sap01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sap00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sap00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sap00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sap00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sap00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2565777..2566739)
Genome map
AA seq 320 aa AA seqDB search
MGEYLAVDVGGTKIAIGLGTDTGQLLETAILKTPAEKAPQDVLDQIADQALAMVHRHGVA
LEAVGVGSPGPLDGPVLLKTSNLSHWEGLNWETGLNTRLHVPVYVENDATAAAVGEWMFG
AGKGTRDLVYVTISTGIGAGFVVNGRVMSGFRGNAGEFGHLVLDPAGPWCPAGHYGCVES
YASGSALTREGRRHQKESPYLDGKESVDAKTVLQGWMRDDPVCGQIVDAATERLGRGLSY
LIDLMNPERIIVGGGVGVNAPERYLTMIESYARQYALPAMMAVVQFRRAQLGEQSGVMGA
LAVAINRQHNPNSLGHAKES
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagtatctggcagtggatgtaggcggcacgaaaattgccatcgggctcggtacc
gacaccgggcagctattagagacagcgatcctgaaaactcccgcggaaaaagcgccccag
gacgttttagatcagattgccgaccaggcgctggcgatggtccatcgccacggggtggcc
ttagaggcggtcggggtcggctcgccgggcccgctcgacggtccggtattacttaaaacg
tccaatttaagccactgggaaggcctcaattgggagaccgggctcaatacccgcctacac
gtaccggtctatgtggaaaacgacgcgaccgccgcggccgtcggcgaatggatgttcgga
gccggcaaaggaacgcgcgacttagtgtacgtgaccatatccacgggaatcggggccggc
tttgtcgtaaacggacgcgtcatgtcaggttttcggggcaatgccggcgaatttgggcat
ctggtgcttgatccggccgggccttggtgtcctgccgggcactacggttgtgtggaaagt
tatgcctccgggtcggccctgacgcgggaagggcggcgtcatcaaaaagaaagcccctat
ctcgacggcaaggagagtgttgacgccaaaaccgtcctgcaaggatggatgcgggacgat
ccggtgtgcggacaaatcgtggacgcggcgaccgagcggttggggcgaggattatcttat
ttaattgatctgatgaatccggagaggattatcgtcgggggcggcgtcggcgtgaacgcg
cctgagcggtatctgacgatgattgagtcctatgcccggcaatatgccttgccggccatg
atggcggtggtgcaatttcgtcgcgcgcaattgggcgaacagtcgggggtcatgggcgct
ttggcggtggccattaatcgccagcataacccgaattcattgggtcatgctaaagaaagc
taa

DBGET integrated database retrieval system